Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2Q8H8

Protein Details
Accession G2Q8H8    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
269-348GVVEVEGRRKKKKKTRPGKKRRIVLRKREKIRREKEAEAERLRMSKEEHLREKKKRLNREKKLKRRQKEREKKMAARAAGBasic
NLS Segment(s)
PositionSequence
275-345GRRKKKKKTRPGKKRRIVLRKREKIRREKEAEAERLRMSKEEHLREKKKRLNREKKLKRRQKEREKKMAAR
Subcellular Location(s) mito 11, nucl 9.5, cyto_nucl 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018555  DUF2011  
KEGG mtm:MYCTH_2300915  -  
Pfam View protein in Pfam  
PF09428  DUF2011  
Amino Acid Sequences MFELPDAKRYVCRPPSLTLGSQGRAHATTAVPATDGLTNRVRREDLFDSASERHSSPELQDEEAAELRAKLNERLAGLLSISIPPPPPAAPAPAPAPEPEPGPEPAETAADADAEDSGEEPQRPQQREGGAKQGADKLEFEFRLFSTPAGAPAPATTSGTGAGASAPPPQKVVQKVVLLPDDEAEAPFDGPAIAPRPLSHYIRGELSEREREQFRRAAVTGREVLSWAAQRAWGLEVPWRVTRVTVSVGSGSAQGSRLGGGGTRGEDPGVVEVEGRRKKKKKTRPGKKRRIVLRKREKIRREKEAEAERLRMSKEEHLREKKKRLNREKKLKRRQKEREKKMAARAAGAAATATATATAATAGGDKEGRGPSASASASEGSDGED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.55
3 0.55
4 0.53
5 0.51
6 0.5
7 0.46
8 0.45
9 0.42
10 0.37
11 0.32
12 0.31
13 0.25
14 0.2
15 0.21
16 0.19
17 0.18
18 0.16
19 0.15
20 0.16
21 0.17
22 0.17
23 0.18
24 0.24
25 0.28
26 0.3
27 0.34
28 0.34
29 0.31
30 0.37
31 0.37
32 0.35
33 0.34
34 0.32
35 0.33
36 0.33
37 0.35
38 0.3
39 0.26
40 0.23
41 0.22
42 0.22
43 0.19
44 0.26
45 0.25
46 0.24
47 0.25
48 0.24
49 0.25
50 0.24
51 0.23
52 0.15
53 0.14
54 0.13
55 0.16
56 0.17
57 0.16
58 0.18
59 0.2
60 0.2
61 0.21
62 0.21
63 0.18
64 0.16
65 0.15
66 0.12
67 0.11
68 0.1
69 0.1
70 0.1
71 0.1
72 0.11
73 0.11
74 0.13
75 0.14
76 0.18
77 0.19
78 0.21
79 0.22
80 0.23
81 0.23
82 0.21
83 0.22
84 0.18
85 0.18
86 0.17
87 0.17
88 0.17
89 0.18
90 0.17
91 0.16
92 0.16
93 0.15
94 0.13
95 0.11
96 0.1
97 0.07
98 0.07
99 0.06
100 0.06
101 0.05
102 0.05
103 0.04
104 0.05
105 0.07
106 0.08
107 0.08
108 0.15
109 0.23
110 0.26
111 0.27
112 0.3
113 0.35
114 0.41
115 0.43
116 0.45
117 0.39
118 0.37
119 0.37
120 0.37
121 0.31
122 0.25
123 0.24
124 0.17
125 0.2
126 0.2
127 0.18
128 0.15
129 0.15
130 0.17
131 0.17
132 0.15
133 0.13
134 0.13
135 0.14
136 0.13
137 0.13
138 0.09
139 0.09
140 0.11
141 0.09
142 0.09
143 0.08
144 0.08
145 0.08
146 0.08
147 0.08
148 0.06
149 0.06
150 0.05
151 0.05
152 0.1
153 0.11
154 0.11
155 0.13
156 0.14
157 0.18
158 0.2
159 0.24
160 0.23
161 0.24
162 0.25
163 0.26
164 0.26
165 0.22
166 0.2
167 0.16
168 0.13
169 0.11
170 0.1
171 0.07
172 0.06
173 0.06
174 0.05
175 0.05
176 0.04
177 0.04
178 0.05
179 0.06
180 0.07
181 0.07
182 0.07
183 0.12
184 0.16
185 0.18
186 0.2
187 0.2
188 0.2
189 0.21
190 0.23
191 0.19
192 0.18
193 0.2
194 0.23
195 0.22
196 0.23
197 0.25
198 0.26
199 0.27
200 0.28
201 0.26
202 0.23
203 0.23
204 0.26
205 0.23
206 0.25
207 0.24
208 0.22
209 0.21
210 0.18
211 0.17
212 0.14
213 0.14
214 0.11
215 0.09
216 0.08
217 0.08
218 0.09
219 0.1
220 0.09
221 0.08
222 0.11
223 0.13
224 0.15
225 0.17
226 0.17
227 0.16
228 0.16
229 0.16
230 0.14
231 0.15
232 0.13
233 0.12
234 0.12
235 0.12
236 0.12
237 0.12
238 0.11
239 0.08
240 0.08
241 0.08
242 0.07
243 0.07
244 0.07
245 0.06
246 0.06
247 0.07
248 0.07
249 0.08
250 0.09
251 0.09
252 0.09
253 0.09
254 0.09
255 0.09
256 0.09
257 0.07
258 0.07
259 0.09
260 0.18
261 0.25
262 0.29
263 0.37
264 0.44
265 0.54
266 0.65
267 0.74
268 0.76
269 0.81
270 0.88
271 0.9
272 0.94
273 0.96
274 0.94
275 0.92
276 0.92
277 0.92
278 0.91
279 0.9
280 0.9
281 0.89
282 0.9
283 0.91
284 0.9
285 0.9
286 0.88
287 0.87
288 0.83
289 0.78
290 0.77
291 0.76
292 0.75
293 0.68
294 0.63
295 0.54
296 0.5
297 0.45
298 0.38
299 0.33
300 0.32
301 0.38
302 0.43
303 0.51
304 0.59
305 0.68
306 0.75
307 0.82
308 0.82
309 0.82
310 0.85
311 0.86
312 0.87
313 0.88
314 0.91
315 0.92
316 0.94
317 0.96
318 0.96
319 0.95
320 0.95
321 0.95
322 0.95
323 0.95
324 0.94
325 0.94
326 0.94
327 0.91
328 0.9
329 0.86
330 0.76
331 0.67
332 0.58
333 0.48
334 0.38
335 0.3
336 0.2
337 0.12
338 0.11
339 0.08
340 0.06
341 0.04
342 0.04
343 0.04
344 0.04
345 0.04
346 0.04
347 0.05
348 0.06
349 0.06
350 0.08
351 0.09
352 0.09
353 0.14
354 0.16
355 0.17
356 0.17
357 0.18
358 0.17
359 0.23
360 0.23
361 0.18
362 0.2
363 0.2
364 0.18
365 0.18