Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Q278

Protein Details
Accession G2Q278   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
95-120QLAAKMHKKRLERLKRKEKRNKLLNSBasic
NLS Segment(s)
PositionSequence
23-116RKNGKQWHAPKKAFRPGSGLTPYEQRAKARVAQAAAKAKEKELKEEKEAERKRRIQALKEKRAAKEEKERYEQLAAKMHKKRLERLKRKEKRNK
Subcellular Location(s) nucl 19, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
KEGG mtm:MYCTH_98838  -  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSTTAVTAAATPEGTVTKPLGMRKNGKQWHAPKKAFRPGSGLTPYEQRAKARVAQAAAKAKEKELKEEKEAERKRRIQALKEKRAAKEEKERYEQLAAKMHKKRLERLKRKEKRNKLLNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.1
4 0.13
5 0.16
6 0.22
7 0.28
8 0.34
9 0.41
10 0.46
11 0.56
12 0.59
13 0.6
14 0.63
15 0.66
16 0.7
17 0.73
18 0.71
19 0.69
20 0.72
21 0.78
22 0.71
23 0.63
24 0.58
25 0.49
26 0.5
27 0.45
28 0.37
29 0.29
30 0.3
31 0.31
32 0.3
33 0.3
34 0.24
35 0.23
36 0.24
37 0.27
38 0.26
39 0.27
40 0.23
41 0.23
42 0.27
43 0.32
44 0.31
45 0.3
46 0.27
47 0.26
48 0.3
49 0.28
50 0.31
51 0.31
52 0.33
53 0.32
54 0.39
55 0.42
56 0.47
57 0.53
58 0.52
59 0.54
60 0.56
61 0.57
62 0.58
63 0.59
64 0.57
65 0.62
66 0.66
67 0.67
68 0.69
69 0.71
70 0.64
71 0.68
72 0.63
73 0.59
74 0.58
75 0.57
76 0.57
77 0.59
78 0.58
79 0.54
80 0.56
81 0.53
82 0.46
83 0.46
84 0.43
85 0.46
86 0.51
87 0.54
88 0.54
89 0.55
90 0.6
91 0.62
92 0.7
93 0.72
94 0.76
95 0.81
96 0.85
97 0.92
98 0.94
99 0.94
100 0.93