Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QNQ0

Protein Details
Accession G2QNQ0   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
5-35TYYNYGKKGHYKRECRSPKKEWKIVPRKEITHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG mtm:MYCTH_2072459  -  
Amino Acid Sequences KSNVTYYNYGKKGHYKRECRSPKKEWKIVPRKEITVINEITKNVIEVAAIGYEDRGSNIDSLGYNSNNKDEQAPYSKLVTIDLEIGLAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.65
3 0.69
4 0.77
5 0.85
6 0.84
7 0.84
8 0.83
9 0.84
10 0.85
11 0.85
12 0.82
13 0.82
14 0.83
15 0.82
16 0.8
17 0.73
18 0.65
19 0.61
20 0.57
21 0.49
22 0.43
23 0.37
24 0.3
25 0.28
26 0.25
27 0.23
28 0.18
29 0.15
30 0.09
31 0.08
32 0.06
33 0.04
34 0.05
35 0.04
36 0.04
37 0.04
38 0.03
39 0.04
40 0.04
41 0.04
42 0.05
43 0.05
44 0.06
45 0.06
46 0.07
47 0.07
48 0.09
49 0.12
50 0.13
51 0.14
52 0.15
53 0.18
54 0.18
55 0.19
56 0.19
57 0.18
58 0.22
59 0.26
60 0.29
61 0.28
62 0.29
63 0.3
64 0.28
65 0.28
66 0.24
67 0.19
68 0.17
69 0.15