Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Q8M5

Protein Details
Accession G2Q8M5   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
68-89ESRPRTGRPRVLTRKAKRNTARBasic
NLS Segment(s)
PositionSequence
74-85GRPRVLTRKAKR
Subcellular Location(s) nucl 13.5, cyto_nucl 11.833, cyto 7, cyto_mito 6.999, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR036388  WH-like_DNA-bd_sf  
KEGG mtm:MYCTH_47994  -  
Amino Acid Sequences MGINLDDFARKLTANHSRNKELSPELRVAICALIAAGRSERSLASLFGVSRHAIHHAVKLWESHNTFESRPRTGRPRVLTRKAKRNTARMVKNGPTFDHKSPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.42
3 0.47
4 0.52
5 0.54
6 0.55
7 0.51
8 0.47
9 0.45
10 0.41
11 0.36
12 0.31
13 0.29
14 0.27
15 0.24
16 0.17
17 0.12
18 0.08
19 0.06
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.06
26 0.07
27 0.06
28 0.08
29 0.08
30 0.08
31 0.08
32 0.09
33 0.09
34 0.09
35 0.11
36 0.09
37 0.09
38 0.09
39 0.1
40 0.1
41 0.11
42 0.13
43 0.14
44 0.15
45 0.15
46 0.16
47 0.15
48 0.19
49 0.2
50 0.19
51 0.19
52 0.2
53 0.2
54 0.26
55 0.29
56 0.28
57 0.29
58 0.33
59 0.37
60 0.42
61 0.49
62 0.5
63 0.57
64 0.63
65 0.71
66 0.76
67 0.78
68 0.82
69 0.8
70 0.83
71 0.79
72 0.78
73 0.78
74 0.78
75 0.77
76 0.74
77 0.76
78 0.73
79 0.73
80 0.66
81 0.59
82 0.57
83 0.55