Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Q2W2

Protein Details
Accession G2Q2W2   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
38-63VRSDETSASRRQKRRREGLVKKLELVHydrophilic
NLS Segment(s)
PositionSequence
48-54RQKRRRE
Subcellular Location(s) plas 16, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038967  Dsc4-like  
IPR013715  DUF1746  
Gene Ontology GO:0044695  C:Dsc E3 ubiquitin ligase complex  
KEGG mtm:MYCTH_2296802  -  
Pfam View protein in Pfam  
PF08508  DUF1746  
Amino Acid Sequences MSEDPGPSSAARQLPPWSDGEYDADEHAVHSENSRHDVRSDETSASRRQKRRREGLVKKLELVRHLQKSLDMIVVVYICTLYYMECSFFRFILRLVPHYSSLSPKDGPLLPLEQPNIYGIFVPSVLCILVHMFFGLPEAGEATRGYLHGGVIIDFIGQKPPTSRLAFLFLDLVILGAQCLMLAVHRELEGLKKAVTPGLRTTSPDLGQPDQITVALATTVQDHDAEERGVLREESLLGYGGGIELQPLSGNGIRQRDGSAMEDERMGNTFSSAADSADMLDVIRSGNAVLGNFHVIHAVRTVGNGAQAAAAYSLSTLGYGATLAALAAERRSRLIRRQQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.34
4 0.31
5 0.27
6 0.28
7 0.28
8 0.25
9 0.23
10 0.21
11 0.2
12 0.17
13 0.15
14 0.15
15 0.13
16 0.11
17 0.12
18 0.17
19 0.18
20 0.24
21 0.26
22 0.26
23 0.25
24 0.29
25 0.29
26 0.31
27 0.32
28 0.3
29 0.31
30 0.35
31 0.42
32 0.48
33 0.55
34 0.57
35 0.64
36 0.71
37 0.78
38 0.84
39 0.86
40 0.88
41 0.88
42 0.9
43 0.91
44 0.83
45 0.77
46 0.72
47 0.63
48 0.55
49 0.52
50 0.5
51 0.44
52 0.43
53 0.38
54 0.34
55 0.34
56 0.33
57 0.27
58 0.18
59 0.12
60 0.12
61 0.12
62 0.1
63 0.08
64 0.06
65 0.04
66 0.05
67 0.05
68 0.04
69 0.06
70 0.07
71 0.09
72 0.09
73 0.12
74 0.13
75 0.14
76 0.14
77 0.13
78 0.13
79 0.18
80 0.2
81 0.2
82 0.23
83 0.24
84 0.25
85 0.26
86 0.27
87 0.24
88 0.25
89 0.26
90 0.23
91 0.21
92 0.23
93 0.22
94 0.22
95 0.2
96 0.2
97 0.17
98 0.2
99 0.21
100 0.17
101 0.16
102 0.16
103 0.15
104 0.12
105 0.11
106 0.08
107 0.07
108 0.07
109 0.07
110 0.06
111 0.05
112 0.05
113 0.04
114 0.04
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.04
121 0.05
122 0.05
123 0.04
124 0.03
125 0.05
126 0.04
127 0.05
128 0.05
129 0.05
130 0.06
131 0.06
132 0.07
133 0.06
134 0.06
135 0.07
136 0.07
137 0.06
138 0.06
139 0.06
140 0.05
141 0.05
142 0.06
143 0.07
144 0.06
145 0.07
146 0.08
147 0.11
148 0.15
149 0.16
150 0.17
151 0.16
152 0.21
153 0.21
154 0.2
155 0.18
156 0.13
157 0.12
158 0.11
159 0.09
160 0.04
161 0.04
162 0.03
163 0.02
164 0.02
165 0.02
166 0.02
167 0.02
168 0.02
169 0.04
170 0.04
171 0.05
172 0.05
173 0.06
174 0.06
175 0.08
176 0.1
177 0.09
178 0.09
179 0.09
180 0.1
181 0.12
182 0.13
183 0.13
184 0.14
185 0.18
186 0.18
187 0.19
188 0.22
189 0.23
190 0.23
191 0.23
192 0.23
193 0.21
194 0.22
195 0.2
196 0.17
197 0.14
198 0.14
199 0.11
200 0.08
201 0.07
202 0.05
203 0.04
204 0.04
205 0.05
206 0.05
207 0.05
208 0.05
209 0.06
210 0.07
211 0.08
212 0.08
213 0.07
214 0.08
215 0.09
216 0.1
217 0.09
218 0.08
219 0.08
220 0.08
221 0.08
222 0.08
223 0.07
224 0.06
225 0.06
226 0.06
227 0.05
228 0.05
229 0.04
230 0.03
231 0.03
232 0.03
233 0.03
234 0.03
235 0.06
236 0.07
237 0.1
238 0.14
239 0.17
240 0.18
241 0.19
242 0.2
243 0.19
244 0.2
245 0.2
246 0.21
247 0.19
248 0.19
249 0.2
250 0.18
251 0.18
252 0.17
253 0.15
254 0.1
255 0.09
256 0.09
257 0.08
258 0.1
259 0.1
260 0.09
261 0.09
262 0.09
263 0.09
264 0.09
265 0.09
266 0.06
267 0.06
268 0.06
269 0.05
270 0.05
271 0.05
272 0.04
273 0.06
274 0.08
275 0.08
276 0.08
277 0.09
278 0.12
279 0.12
280 0.12
281 0.13
282 0.12
283 0.13
284 0.13
285 0.13
286 0.11
287 0.11
288 0.13
289 0.11
290 0.12
291 0.12
292 0.11
293 0.1
294 0.09
295 0.09
296 0.08
297 0.08
298 0.06
299 0.06
300 0.06
301 0.05
302 0.05
303 0.05
304 0.04
305 0.05
306 0.05
307 0.04
308 0.04
309 0.04
310 0.04
311 0.04
312 0.05
313 0.06
314 0.09
315 0.12
316 0.12
317 0.16
318 0.22
319 0.28
320 0.37