Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QBF8

Protein Details
Accession G2QBF8   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-38TCYNYGKKGHYKRECRSPKKEWKLVPRKEIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG mtm:MYCTH_2060623  -  
Amino Acid Sequences MTKDKSNVTCYNYGKKGHYKRECRSPKKEWKLVPRKEIADIDKTTKNVTEVVATSYEDRGSDTDSFGHDGNGKDKQVLYSELVTVNLEIGLAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.58
3 0.62
4 0.64
5 0.7
6 0.7
7 0.72
8 0.8
9 0.85
10 0.84
11 0.83
12 0.82
13 0.84
14 0.84
15 0.84
16 0.81
17 0.81
18 0.83
19 0.81
20 0.77
21 0.72
22 0.63
23 0.59
24 0.55
25 0.47
26 0.42
27 0.36
28 0.33
29 0.3
30 0.29
31 0.26
32 0.22
33 0.2
34 0.15
35 0.14
36 0.11
37 0.09
38 0.1
39 0.1
40 0.1
41 0.1
42 0.1
43 0.1
44 0.09
45 0.09
46 0.08
47 0.1
48 0.1
49 0.1
50 0.11
51 0.12
52 0.13
53 0.13
54 0.13
55 0.13
56 0.14
57 0.17
58 0.21
59 0.2
60 0.2
61 0.2
62 0.21
63 0.21
64 0.22
65 0.21
66 0.18
67 0.2
68 0.19
69 0.19
70 0.18
71 0.15
72 0.13
73 0.1