Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QIK7

Protein Details
Accession G2QIK7   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
84-103IPHHRDQHWRRSRPNRTVQAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 14, cyto 10
Family & Domain DBs
KEGG mtm:MYCTH_96290  -  
Amino Acid Sequences MAEVPAFTQETSALRRIDLGDVPGYIPRELDNAKILTAAVLRGSQIRVSSRNIVEEQTSLSSHAPGHPVGDLHGYLSCPLPPIIPHHRDQHWRRSRPNRTVQAVTAVQEVQGVAAHSRTQAPLIRPLTACRRRGARRYWPRSLAFSLDCSPGHPSDNVTMYDTLVVWSIRKFFPCSTPLGQGAKVALFRGSERNKRCPEVVMHPKRPLRRSGAGGLDWVKSGSSVTPRDIPQSYSLLDTGISEPAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.23
4 0.25
5 0.23
6 0.22
7 0.18
8 0.18
9 0.19
10 0.2
11 0.2
12 0.17
13 0.15
14 0.13
15 0.17
16 0.17
17 0.18
18 0.2
19 0.19
20 0.19
21 0.19
22 0.18
23 0.15
24 0.14
25 0.13
26 0.09
27 0.08
28 0.09
29 0.11
30 0.12
31 0.12
32 0.14
33 0.17
34 0.19
35 0.23
36 0.29
37 0.28
38 0.31
39 0.31
40 0.3
41 0.27
42 0.25
43 0.23
44 0.18
45 0.17
46 0.14
47 0.14
48 0.13
49 0.13
50 0.14
51 0.14
52 0.12
53 0.13
54 0.12
55 0.12
56 0.11
57 0.13
58 0.11
59 0.09
60 0.1
61 0.09
62 0.09
63 0.1
64 0.09
65 0.08
66 0.09
67 0.08
68 0.08
69 0.15
70 0.23
71 0.26
72 0.29
73 0.34
74 0.39
75 0.48
76 0.52
77 0.57
78 0.59
79 0.62
80 0.68
81 0.73
82 0.77
83 0.77
84 0.82
85 0.79
86 0.74
87 0.7
88 0.61
89 0.55
90 0.47
91 0.38
92 0.29
93 0.21
94 0.15
95 0.13
96 0.12
97 0.06
98 0.06
99 0.05
100 0.04
101 0.05
102 0.05
103 0.05
104 0.06
105 0.06
106 0.08
107 0.1
108 0.12
109 0.19
110 0.2
111 0.21
112 0.21
113 0.24
114 0.32
115 0.36
116 0.37
117 0.32
118 0.39
119 0.42
120 0.49
121 0.54
122 0.54
123 0.59
124 0.65
125 0.68
126 0.67
127 0.63
128 0.6
129 0.54
130 0.47
131 0.36
132 0.31
133 0.27
134 0.23
135 0.21
136 0.18
137 0.19
138 0.16
139 0.17
140 0.14
141 0.14
142 0.14
143 0.17
144 0.17
145 0.16
146 0.16
147 0.14
148 0.14
149 0.13
150 0.1
151 0.09
152 0.08
153 0.07
154 0.07
155 0.11
156 0.11
157 0.13
158 0.16
159 0.16
160 0.21
161 0.23
162 0.28
163 0.28
164 0.3
165 0.33
166 0.32
167 0.31
168 0.27
169 0.26
170 0.22
171 0.19
172 0.16
173 0.13
174 0.11
175 0.12
176 0.21
177 0.27
178 0.34
179 0.4
180 0.49
181 0.53
182 0.56
183 0.56
184 0.51
185 0.49
186 0.51
187 0.56
188 0.57
189 0.59
190 0.64
191 0.69
192 0.72
193 0.71
194 0.67
195 0.63
196 0.6
197 0.58
198 0.56
199 0.56
200 0.49
201 0.49
202 0.44
203 0.37
204 0.31
205 0.26
206 0.19
207 0.13
208 0.13
209 0.12
210 0.17
211 0.19
212 0.22
213 0.27
214 0.29
215 0.35
216 0.35
217 0.35
218 0.32
219 0.33
220 0.3
221 0.27
222 0.26
223 0.2
224 0.19
225 0.18
226 0.15