Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Q6M9

Protein Details
Accession G2Q6M9    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-49KAPQPGWMHKQKKPKNNKDQQLERPRRRRRRRNRYTDDEDDDYBasic
NLS Segment(s)
PositionSequence
15-39HKQKKPKNNKDQQLERPRRRRRRRN
Subcellular Location(s) nucl 23, mito 2
Family & Domain DBs
KEGG mtm:MYCTH_2314307  -  
Amino Acid Sequences MPKDDEKAPQPGWMHKQKKPKNNKDQQLERPRRRRRRRNRYTDDEDDDYDNNEGYDQQFPLRQRQQQQQQQMQQQGGDGGKNPLRLRLDLNLDVEIELKAHIHGDLTLALLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.66
4 0.69
5 0.76
6 0.8
7 0.82
8 0.83
9 0.86
10 0.89
11 0.89
12 0.9
13 0.9
14 0.9
15 0.9
16 0.89
17 0.89
18 0.9
19 0.91
20 0.93
21 0.93
22 0.93
23 0.94
24 0.95
25 0.95
26 0.94
27 0.92
28 0.9
29 0.86
30 0.8
31 0.71
32 0.61
33 0.51
34 0.42
35 0.33
36 0.25
37 0.17
38 0.11
39 0.08
40 0.07
41 0.06
42 0.07
43 0.07
44 0.07
45 0.11
46 0.12
47 0.2
48 0.25
49 0.28
50 0.33
51 0.41
52 0.51
53 0.55
54 0.62
55 0.62
56 0.64
57 0.65
58 0.63
59 0.55
60 0.45
61 0.38
62 0.32
63 0.25
64 0.19
65 0.14
66 0.14
67 0.16
68 0.21
69 0.21
70 0.23
71 0.25
72 0.26
73 0.28
74 0.29
75 0.34
76 0.32
77 0.33
78 0.28
79 0.26
80 0.25
81 0.23
82 0.17
83 0.11
84 0.08
85 0.07
86 0.06
87 0.07
88 0.07
89 0.07
90 0.07
91 0.08
92 0.08