Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QAT3

Protein Details
Accession G2QAT3    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
111-131PNCAAPTPSSRRKRRFESDETHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR032054  Cdt1_C  
IPR038090  Cdt1_C_WH_dom_sf  
Gene Ontology GO:0007049  P:cell cycle  
KEGG mtm:MYCTH_2116588  -  
Pfam View protein in Pfam  
PF16679  CDT1_C  
Amino Acid Sequences MPGVLTRNTRVPRGHSDSSTPATGTTKCNKLSKAQAAGKQSQTSAPFTPRSSNIEIVLPSRKRKVQDAAECKSKKIRFEPETSIAPATPVSRKRKGARFAEPDAAAAPSTPNCAAPTPSSRRKRRFESDETSQAEELLERLNLQSSPVSKRSKTTVHRRAPQNDFDLPNELLDLLDLHEAFLKTLNMQYAHNGTTSPIDLRTLYTSVTRAWGKRHVMLDDIQRCVGVLSWTPTRTMGAQPTAPFYLTDYGRDKICIEFHPSAERGPLREPKLKMDFEANLRTLWLSRSNNIPPTIFIGTLPKAPLHPKNASMMNPLLAASAKTQTTLDAFKQSIAEKKQQDEAAKKQAAAAAAAANGPSGGSLLDRIRLKETLASQSPQNEPTAADLQRRRALQRAADVAAVIGMLCKATVATGSGQARVSFSMAALMVRLKDSVRTPVSQEDGMLCVRLLAAEVAPHWLKIVKIGGRENVVCTMGMQPTKAEVEDRVKALLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.53
3 0.55
4 0.56
5 0.56
6 0.51
7 0.41
8 0.34
9 0.32
10 0.31
11 0.33
12 0.34
13 0.37
14 0.41
15 0.46
16 0.47
17 0.51
18 0.58
19 0.6
20 0.62
21 0.63
22 0.63
23 0.65
24 0.69
25 0.67
26 0.59
27 0.52
28 0.47
29 0.42
30 0.41
31 0.38
32 0.36
33 0.36
34 0.35
35 0.4
36 0.38
37 0.42
38 0.42
39 0.41
40 0.37
41 0.36
42 0.35
43 0.33
44 0.39
45 0.37
46 0.38
47 0.42
48 0.45
49 0.45
50 0.5
51 0.56
52 0.57
53 0.63
54 0.67
55 0.67
56 0.72
57 0.7
58 0.66
59 0.66
60 0.59
61 0.55
62 0.54
63 0.58
64 0.54
65 0.59
66 0.65
67 0.61
68 0.61
69 0.57
70 0.5
71 0.39
72 0.33
73 0.28
74 0.23
75 0.25
76 0.29
77 0.35
78 0.4
79 0.48
80 0.56
81 0.64
82 0.7
83 0.71
84 0.73
85 0.72
86 0.7
87 0.69
88 0.61
89 0.53
90 0.44
91 0.36
92 0.26
93 0.19
94 0.15
95 0.09
96 0.11
97 0.11
98 0.11
99 0.12
100 0.14
101 0.15
102 0.18
103 0.26
104 0.32
105 0.42
106 0.51
107 0.6
108 0.68
109 0.74
110 0.79
111 0.8
112 0.8
113 0.79
114 0.77
115 0.75
116 0.75
117 0.7
118 0.63
119 0.53
120 0.44
121 0.36
122 0.27
123 0.2
124 0.12
125 0.09
126 0.06
127 0.07
128 0.08
129 0.08
130 0.09
131 0.11
132 0.13
133 0.18
134 0.25
135 0.3
136 0.29
137 0.32
138 0.37
139 0.43
140 0.49
141 0.55
142 0.58
143 0.63
144 0.71
145 0.76
146 0.79
147 0.76
148 0.73
149 0.67
150 0.61
151 0.54
152 0.47
153 0.43
154 0.34
155 0.28
156 0.23
157 0.17
158 0.12
159 0.1
160 0.08
161 0.05
162 0.06
163 0.06
164 0.06
165 0.08
166 0.08
167 0.08
168 0.09
169 0.09
170 0.08
171 0.1
172 0.12
173 0.11
174 0.11
175 0.13
176 0.14
177 0.14
178 0.14
179 0.13
180 0.11
181 0.11
182 0.12
183 0.11
184 0.08
185 0.09
186 0.09
187 0.1
188 0.11
189 0.11
190 0.1
191 0.11
192 0.11
193 0.11
194 0.15
195 0.16
196 0.16
197 0.18
198 0.24
199 0.26
200 0.3
201 0.31
202 0.28
203 0.27
204 0.29
205 0.34
206 0.31
207 0.29
208 0.25
209 0.22
210 0.21
211 0.19
212 0.17
213 0.1
214 0.07
215 0.09
216 0.12
217 0.12
218 0.13
219 0.13
220 0.13
221 0.13
222 0.14
223 0.14
224 0.13
225 0.15
226 0.15
227 0.17
228 0.17
229 0.15
230 0.13
231 0.12
232 0.14
233 0.12
234 0.15
235 0.16
236 0.16
237 0.16
238 0.17
239 0.17
240 0.14
241 0.16
242 0.14
243 0.17
244 0.18
245 0.18
246 0.21
247 0.21
248 0.2
249 0.21
250 0.21
251 0.16
252 0.19
253 0.25
254 0.26
255 0.32
256 0.33
257 0.36
258 0.42
259 0.41
260 0.37
261 0.34
262 0.32
263 0.29
264 0.33
265 0.27
266 0.2
267 0.2
268 0.19
269 0.16
270 0.15
271 0.18
272 0.16
273 0.16
274 0.22
275 0.25
276 0.29
277 0.29
278 0.28
279 0.21
280 0.24
281 0.24
282 0.19
283 0.16
284 0.16
285 0.15
286 0.16
287 0.17
288 0.13
289 0.13
290 0.18
291 0.23
292 0.25
293 0.26
294 0.26
295 0.3
296 0.33
297 0.32
298 0.31
299 0.27
300 0.22
301 0.2
302 0.18
303 0.14
304 0.11
305 0.1
306 0.08
307 0.1
308 0.09
309 0.09
310 0.09
311 0.1
312 0.12
313 0.13
314 0.14
315 0.15
316 0.16
317 0.16
318 0.18
319 0.19
320 0.24
321 0.25
322 0.32
323 0.3
324 0.32
325 0.37
326 0.39
327 0.42
328 0.42
329 0.45
330 0.47
331 0.45
332 0.43
333 0.39
334 0.37
335 0.32
336 0.26
337 0.2
338 0.11
339 0.1
340 0.1
341 0.09
342 0.06
343 0.06
344 0.05
345 0.04
346 0.03
347 0.03
348 0.03
349 0.06
350 0.07
351 0.13
352 0.14
353 0.16
354 0.19
355 0.19
356 0.2
357 0.22
358 0.24
359 0.27
360 0.29
361 0.29
362 0.28
363 0.32
364 0.34
365 0.32
366 0.29
367 0.22
368 0.19
369 0.22
370 0.26
371 0.23
372 0.28
373 0.3
374 0.35
375 0.4
376 0.42
377 0.4
378 0.41
379 0.43
380 0.4
381 0.43
382 0.42
383 0.38
384 0.36
385 0.33
386 0.26
387 0.21
388 0.17
389 0.1
390 0.05
391 0.04
392 0.03
393 0.03
394 0.03
395 0.03
396 0.03
397 0.04
398 0.05
399 0.07
400 0.14
401 0.15
402 0.18
403 0.19
404 0.19
405 0.2
406 0.19
407 0.19
408 0.12
409 0.11
410 0.11
411 0.1
412 0.1
413 0.1
414 0.1
415 0.1
416 0.1
417 0.11
418 0.1
419 0.13
420 0.16
421 0.23
422 0.25
423 0.27
424 0.29
425 0.34
426 0.37
427 0.34
428 0.33
429 0.26
430 0.25
431 0.23
432 0.2
433 0.14
434 0.11
435 0.1
436 0.09
437 0.08
438 0.07
439 0.07
440 0.07
441 0.08
442 0.14
443 0.14
444 0.14
445 0.14
446 0.15
447 0.15
448 0.18
449 0.25
450 0.23
451 0.29
452 0.34
453 0.37
454 0.41
455 0.42
456 0.4
457 0.36
458 0.33
459 0.27
460 0.23
461 0.23
462 0.23
463 0.23
464 0.21
465 0.18
466 0.21
467 0.23
468 0.23
469 0.21
470 0.21
471 0.27
472 0.31
473 0.32