Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2QKJ1

Protein Details
Accession G2QKJ1    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
58-83QAYRDCKKAWIEKRKMEKKKAGGFFSHydrophilic
NLS Segment(s)
PositionSequence
70-78KRKMEKKKA
Subcellular Location(s) nucl 14, cyto_nucl 13, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR010625  CHCH  
IPR009069  Cys_alpha_HP_mot_SF  
KEGG mtm:MYCTH_2308951  -  
Pfam View protein in Pfam  
PF06747  CHCH  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MASTVNRAVDPWNQETKEKFEGKDRSEYLDPCQEAAARSIRCLNRNGGDRTLCSDYFQAYRDCKKAWIEKRKMEKKKAGGFFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.4
3 0.43
4 0.46
5 0.43
6 0.39
7 0.4
8 0.46
9 0.46
10 0.52
11 0.47
12 0.45
13 0.45
14 0.44
15 0.39
16 0.38
17 0.35
18 0.27
19 0.26
20 0.21
21 0.18
22 0.19
23 0.21
24 0.15
25 0.15
26 0.21
27 0.23
28 0.24
29 0.25
30 0.26
31 0.25
32 0.31
33 0.33
34 0.31
35 0.3
36 0.28
37 0.31
38 0.32
39 0.27
40 0.22
41 0.2
42 0.18
43 0.19
44 0.2
45 0.2
46 0.21
47 0.26
48 0.28
49 0.28
50 0.3
51 0.35
52 0.44
53 0.5
54 0.56
55 0.6
56 0.66
57 0.77
58 0.83
59 0.87
60 0.87
61 0.86
62 0.85
63 0.86