Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Q069

Protein Details
Accession G2Q069    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
8-39VTCYNCGKKGHYKQECRSPKKEWKPTPGKEITHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG mtm:MYCTH_2124700  -  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MTKDKSNVTCYNCGKKGHYKQECRSPKKEWKPTPGKEITAIDETTKDVIEVAATSYEDKGSDTDSLGHDGNGEDEQVPNSELVTVDLETGLAEWDMAGEYVPPASILPALG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.62
3 0.66
4 0.68
5 0.71
6 0.71
7 0.74
8 0.81
9 0.86
10 0.83
11 0.79
12 0.77
13 0.78
14 0.79
15 0.82
16 0.79
17 0.79
18 0.82
19 0.8
20 0.81
21 0.74
22 0.65
23 0.58
24 0.51
25 0.44
26 0.36
27 0.32
28 0.23
29 0.19
30 0.18
31 0.15
32 0.13
33 0.09
34 0.06
35 0.05
36 0.05
37 0.05
38 0.04
39 0.04
40 0.04
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.07
49 0.07
50 0.08
51 0.09
52 0.11
53 0.11
54 0.11
55 0.1
56 0.09
57 0.1
58 0.08
59 0.08
60 0.06
61 0.06
62 0.07
63 0.07
64 0.08
65 0.07
66 0.07
67 0.07
68 0.06
69 0.07
70 0.08
71 0.08
72 0.08
73 0.07
74 0.07
75 0.07
76 0.07
77 0.06
78 0.04
79 0.04
80 0.03
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.06