Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QBT8

Protein Details
Accession G2QBT8    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-56ALRPHVLKNPPTRKMRKQARKRGKDEDDRFRRFRBasic
NLS Segment(s)
PositionSequence
30-56KNPPTRKMRKQARKRGKDEDDRFRRFR
Subcellular Location(s) cyto 10, nucl 6, mito 5, cysk 3, plas 1, extr 1, pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR004276  GlycoTrans_28_N  
Gene Ontology GO:0016758  F:hexosyltransferase activity  
GO:0005975  P:carbohydrate metabolic process  
GO:0030259  P:lipid glycosylation  
KEGG mtm:MYCTH_2304973  -  
Pfam View protein in Pfam  
PF03033  Glyco_transf_28  
Amino Acid Sequences MTTASPEEGLALGAGCQATIYPALRPHVLKNPPTRKMRKQARKRGKDEDDRFRRFRISNEHSRTKGRVSRQDGRLNISLHDTSNAGYLAKALGTAAHKMVPLARTSEEEKREEEAEPPASPGRQKPDVRPTAPVGPPLPPPPRLNIVIMVIGSRGDAQPFLKIARILHAQYGHRVRIATHPAFCTFVQEDCPGIEFFTVGGDPSELMVCHASLCLLPTSIAPRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.05
3 0.05
4 0.05
5 0.06
6 0.09
7 0.09
8 0.11
9 0.15
10 0.18
11 0.22
12 0.24
13 0.27
14 0.34
15 0.41
16 0.45
17 0.52
18 0.6
19 0.65
20 0.73
21 0.77
22 0.77
23 0.81
24 0.85
25 0.85
26 0.86
27 0.89
28 0.91
29 0.92
30 0.9
31 0.9
32 0.88
33 0.88
34 0.86
35 0.86
36 0.85
37 0.82
38 0.77
39 0.68
40 0.64
41 0.55
42 0.51
43 0.51
44 0.49
45 0.52
46 0.57
47 0.63
48 0.6
49 0.63
50 0.59
51 0.56
52 0.54
53 0.51
54 0.52
55 0.53
56 0.6
57 0.63
58 0.68
59 0.62
60 0.62
61 0.59
62 0.5
63 0.42
64 0.36
65 0.29
66 0.22
67 0.21
68 0.16
69 0.11
70 0.12
71 0.11
72 0.08
73 0.07
74 0.07
75 0.06
76 0.05
77 0.05
78 0.04
79 0.05
80 0.06
81 0.07
82 0.08
83 0.08
84 0.09
85 0.09
86 0.11
87 0.1
88 0.1
89 0.11
90 0.11
91 0.12
92 0.16
93 0.21
94 0.23
95 0.23
96 0.23
97 0.23
98 0.24
99 0.22
100 0.2
101 0.17
102 0.16
103 0.15
104 0.15
105 0.14
106 0.13
107 0.14
108 0.15
109 0.18
110 0.24
111 0.26
112 0.31
113 0.4
114 0.46
115 0.46
116 0.47
117 0.45
118 0.44
119 0.43
120 0.4
121 0.31
122 0.26
123 0.27
124 0.3
125 0.3
126 0.26
127 0.27
128 0.27
129 0.3
130 0.3
131 0.29
132 0.24
133 0.22
134 0.19
135 0.18
136 0.15
137 0.11
138 0.09
139 0.08
140 0.07
141 0.06
142 0.05
143 0.06
144 0.07
145 0.09
146 0.1
147 0.1
148 0.11
149 0.13
150 0.13
151 0.16
152 0.2
153 0.19
154 0.22
155 0.26
156 0.25
157 0.31
158 0.36
159 0.32
160 0.3
161 0.29
162 0.27
163 0.3
164 0.37
165 0.34
166 0.32
167 0.33
168 0.33
169 0.36
170 0.34
171 0.32
172 0.25
173 0.22
174 0.22
175 0.21
176 0.21
177 0.18
178 0.2
179 0.15
180 0.14
181 0.13
182 0.09
183 0.08
184 0.09
185 0.08
186 0.07
187 0.07
188 0.07
189 0.07
190 0.08
191 0.09
192 0.07
193 0.09
194 0.09
195 0.09
196 0.09
197 0.09
198 0.08
199 0.08
200 0.1
201 0.09
202 0.09
203 0.1
204 0.11