Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QB92

Protein Details
Accession G2QB92   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
315-335YGWSRAFCERMKRRRRGGSGQHydrophilic
NLS Segment(s)
PositionSequence
326-331KRRRRG
Subcellular Location(s) nucl 11, cyto 10.5, cyto_mito 8, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039037  CHERP  
IPR006569  CID_dom  
IPR008942  ENTH_VHS  
Gene Ontology GO:0006874  P:intracellular calcium ion homeostasis  
KEGG mtm:MYCTH_2058345  -  
Pfam View protein in Pfam  
PF04818  CID  
PROSITE View protein in PROSITE  
PS51391  CID  
Amino Acid Sequences MASAELIVAKTALSGALFRADPRPCSRDDIESMLALVNSTITECSPSNVQRCKQWALSNLVPSSSRIAPFCKYLVALSKSFEGPSHVPAGEPKSGRIPSAKRRRLHVLYILSDILYHVYHRDRDKEFAQKLEPTLPALVRSAASFINCPKHIRKIHDLIGLWEENGYFAPSFIQQLRAAVDEGPSSSDEGKNDKDADTSTDPVAKAAKTAPWVMPAMHGDPSTPWYDLPAGNWLPALEPNSTRPMNPSMIKPLVLSQGPADKSLVEAVKKLLADIDKIYSPEPNHDESPPCIGPLGERIEIDEITGEIIGGDTYYGWSRAFCERMKRRRRGGSGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.11
4 0.11
5 0.13
6 0.2
7 0.22
8 0.27
9 0.33
10 0.36
11 0.35
12 0.42
13 0.43
14 0.42
15 0.43
16 0.44
17 0.39
18 0.36
19 0.34
20 0.28
21 0.24
22 0.18
23 0.14
24 0.08
25 0.06
26 0.06
27 0.06
28 0.06
29 0.09
30 0.09
31 0.11
32 0.17
33 0.22
34 0.3
35 0.38
36 0.4
37 0.44
38 0.49
39 0.52
40 0.52
41 0.52
42 0.51
43 0.51
44 0.53
45 0.53
46 0.48
47 0.44
48 0.39
49 0.34
50 0.32
51 0.27
52 0.24
53 0.2
54 0.22
55 0.23
56 0.24
57 0.24
58 0.21
59 0.18
60 0.18
61 0.25
62 0.26
63 0.25
64 0.24
65 0.25
66 0.25
67 0.25
68 0.23
69 0.2
70 0.18
71 0.19
72 0.21
73 0.18
74 0.18
75 0.2
76 0.24
77 0.25
78 0.24
79 0.23
80 0.26
81 0.26
82 0.27
83 0.31
84 0.34
85 0.39
86 0.5
87 0.56
88 0.53
89 0.57
90 0.65
91 0.63
92 0.61
93 0.58
94 0.53
95 0.47
96 0.46
97 0.41
98 0.31
99 0.27
100 0.22
101 0.15
102 0.09
103 0.07
104 0.08
105 0.1
106 0.15
107 0.17
108 0.23
109 0.24
110 0.28
111 0.32
112 0.38
113 0.38
114 0.37
115 0.37
116 0.33
117 0.32
118 0.32
119 0.28
120 0.2
121 0.2
122 0.17
123 0.15
124 0.14
125 0.13
126 0.1
127 0.09
128 0.09
129 0.08
130 0.09
131 0.09
132 0.11
133 0.16
134 0.16
135 0.2
136 0.21
137 0.29
138 0.33
139 0.37
140 0.42
141 0.42
142 0.45
143 0.47
144 0.44
145 0.37
146 0.36
147 0.3
148 0.23
149 0.18
150 0.13
151 0.08
152 0.08
153 0.08
154 0.04
155 0.04
156 0.05
157 0.05
158 0.07
159 0.07
160 0.1
161 0.09
162 0.1
163 0.11
164 0.11
165 0.11
166 0.1
167 0.1
168 0.07
169 0.07
170 0.08
171 0.07
172 0.07
173 0.08
174 0.09
175 0.09
176 0.12
177 0.13
178 0.15
179 0.15
180 0.15
181 0.14
182 0.14
183 0.18
184 0.17
185 0.18
186 0.16
187 0.18
188 0.18
189 0.18
190 0.19
191 0.13
192 0.12
193 0.12
194 0.13
195 0.12
196 0.14
197 0.14
198 0.15
199 0.16
200 0.15
201 0.16
202 0.16
203 0.16
204 0.15
205 0.15
206 0.12
207 0.12
208 0.15
209 0.14
210 0.13
211 0.11
212 0.11
213 0.13
214 0.13
215 0.13
216 0.17
217 0.16
218 0.16
219 0.16
220 0.14
221 0.13
222 0.15
223 0.16
224 0.11
225 0.12
226 0.15
227 0.21
228 0.21
229 0.21
230 0.22
231 0.24
232 0.27
233 0.28
234 0.29
235 0.3
236 0.31
237 0.32
238 0.29
239 0.27
240 0.26
241 0.24
242 0.22
243 0.16
244 0.21
245 0.21
246 0.22
247 0.2
248 0.15
249 0.16
250 0.19
251 0.21
252 0.15
253 0.15
254 0.16
255 0.19
256 0.19
257 0.18
258 0.17
259 0.15
260 0.16
261 0.17
262 0.19
263 0.17
264 0.18
265 0.19
266 0.2
267 0.2
268 0.25
269 0.27
270 0.29
271 0.3
272 0.32
273 0.34
274 0.32
275 0.39
276 0.32
277 0.28
278 0.24
279 0.21
280 0.2
281 0.22
282 0.26
283 0.2
284 0.2
285 0.21
286 0.23
287 0.23
288 0.22
289 0.16
290 0.11
291 0.1
292 0.1
293 0.08
294 0.05
295 0.05
296 0.05
297 0.04
298 0.04
299 0.04
300 0.06
301 0.07
302 0.09
303 0.09
304 0.1
305 0.13
306 0.19
307 0.24
308 0.27
309 0.36
310 0.46
311 0.57
312 0.67
313 0.74
314 0.78
315 0.83