Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Q7T8

Protein Details
Accession G2Q7T8    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
91-115KTFEKLIREKPKPGFKRKRKTVAANBasic
NLS Segment(s)
PositionSequence
97-111IREKPKPGFKRKRKT
Subcellular Location(s) cyto_nucl 11, nucl 9.5, cyto 9.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001000  GH10_dom  
IPR017853  Glycoside_hydrolase_SF  
Gene Ontology GO:0031176  F:endo-1,4-beta-xylanase activity  
GO:0005975  P:carbohydrate metabolic process  
KEGG mtm:MYCTH_2125938  -  
Pfam View protein in Pfam  
PF00331  Glyco_hydro_10  
PROSITE View protein in PROSITE  
PS51760  GH10_2  
Amino Acid Sequences MLNLSHTEHTLFRPLPLSLPHHHHHHHFIVGRRPPEALRGAITRHIRAVAGYYRGRCYAWDVVNEALDEDGTYRKSLFYNVLGDEYIRIVKTFEKLIREKPKPGFKRKRKTVAAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.27
4 0.29
5 0.27
6 0.33
7 0.35
8 0.39
9 0.41
10 0.42
11 0.44
12 0.42
13 0.43
14 0.41
15 0.43
16 0.45
17 0.48
18 0.46
19 0.4
20 0.39
21 0.34
22 0.33
23 0.3
24 0.22
25 0.19
26 0.19
27 0.2
28 0.25
29 0.27
30 0.23
31 0.21
32 0.2
33 0.18
34 0.16
35 0.17
36 0.13
37 0.16
38 0.18
39 0.18
40 0.19
41 0.2
42 0.2
43 0.17
44 0.19
45 0.19
46 0.19
47 0.19
48 0.19
49 0.19
50 0.19
51 0.19
52 0.14
53 0.09
54 0.07
55 0.06
56 0.05
57 0.06
58 0.06
59 0.07
60 0.07
61 0.08
62 0.08
63 0.1
64 0.12
65 0.13
66 0.15
67 0.16
68 0.17
69 0.16
70 0.16
71 0.15
72 0.13
73 0.12
74 0.09
75 0.09
76 0.08
77 0.1
78 0.13
79 0.18
80 0.2
81 0.26
82 0.3
83 0.4
84 0.5
85 0.53
86 0.59
87 0.62
88 0.69
89 0.72
90 0.79
91 0.81
92 0.81
93 0.88
94 0.9
95 0.92