Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Q6G4

Protein Details
Accession G2Q6G4    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
135-154GSGGRRRRRGWRIAWKQRHGBasic
NLS Segment(s)
PositionSequence
138-148GRRRRRGWRIA
Subcellular Location(s) cyto_nucl 7.5, nucl 7, mito 7, cyto 6, pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR023393  START-like_dom_sf  
KEGG mtm:MYCTH_77895  -  
CDD cd07822  SRPBCC_4  
Amino Acid Sequences MSDEPSSHAVTGPPIPTITYGSGGSFSVSCSSRIAATPKECLDVVTAASEYPAWNRFCRKCTIDAQPPAAAAAAATAARNSDDGPCPDTFLRLGTQFTFDVHLDPEGPDGKPGRPTALEVSVLEPIDEEEDPGDGSGGRRRRRGWRIAWKQRHGLLMPAAMLRSERVQEFVEVAGDGDGRPPGTQYYCWETFYGPLAPVVRLIVGRQVERGFDAWLRGLKARVEMTGQGQGQGQGQGRGGCLKEGKRTDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.18
4 0.2
5 0.19
6 0.17
7 0.16
8 0.15
9 0.16
10 0.16
11 0.15
12 0.12
13 0.11
14 0.13
15 0.14
16 0.14
17 0.14
18 0.15
19 0.15
20 0.18
21 0.22
22 0.24
23 0.26
24 0.31
25 0.31
26 0.32
27 0.31
28 0.28
29 0.26
30 0.2
31 0.18
32 0.14
33 0.13
34 0.1
35 0.1
36 0.1
37 0.08
38 0.1
39 0.15
40 0.16
41 0.2
42 0.28
43 0.33
44 0.36
45 0.42
46 0.43
47 0.43
48 0.47
49 0.53
50 0.54
51 0.55
52 0.56
53 0.49
54 0.46
55 0.4
56 0.33
57 0.24
58 0.14
59 0.08
60 0.05
61 0.05
62 0.05
63 0.04
64 0.04
65 0.05
66 0.06
67 0.06
68 0.08
69 0.11
70 0.13
71 0.16
72 0.16
73 0.18
74 0.18
75 0.18
76 0.16
77 0.14
78 0.14
79 0.12
80 0.13
81 0.11
82 0.14
83 0.13
84 0.13
85 0.14
86 0.12
87 0.12
88 0.11
89 0.11
90 0.09
91 0.09
92 0.1
93 0.09
94 0.09
95 0.1
96 0.11
97 0.12
98 0.15
99 0.15
100 0.16
101 0.15
102 0.16
103 0.17
104 0.17
105 0.17
106 0.14
107 0.15
108 0.14
109 0.14
110 0.12
111 0.09
112 0.07
113 0.08
114 0.07
115 0.06
116 0.04
117 0.05
118 0.05
119 0.05
120 0.05
121 0.03
122 0.04
123 0.09
124 0.16
125 0.19
126 0.23
127 0.27
128 0.36
129 0.44
130 0.51
131 0.56
132 0.61
133 0.69
134 0.76
135 0.82
136 0.77
137 0.75
138 0.7
139 0.64
140 0.53
141 0.44
142 0.34
143 0.26
144 0.22
145 0.18
146 0.15
147 0.11
148 0.11
149 0.08
150 0.08
151 0.09
152 0.08
153 0.1
154 0.11
155 0.11
156 0.12
157 0.12
158 0.11
159 0.09
160 0.09
161 0.07
162 0.06
163 0.06
164 0.06
165 0.06
166 0.06
167 0.06
168 0.06
169 0.08
170 0.1
171 0.12
172 0.15
173 0.22
174 0.23
175 0.25
176 0.25
177 0.23
178 0.23
179 0.24
180 0.22
181 0.15
182 0.16
183 0.16
184 0.15
185 0.15
186 0.14
187 0.12
188 0.11
189 0.11
190 0.14
191 0.15
192 0.16
193 0.18
194 0.19
195 0.19
196 0.2
197 0.21
198 0.17
199 0.16
200 0.17
201 0.17
202 0.19
203 0.2
204 0.21
205 0.22
206 0.21
207 0.25
208 0.24
209 0.23
210 0.23
211 0.23
212 0.24
213 0.29
214 0.28
215 0.24
216 0.24
217 0.24
218 0.22
219 0.25
220 0.23
221 0.18
222 0.2
223 0.2
224 0.2
225 0.23
226 0.23
227 0.22
228 0.27
229 0.29
230 0.36