Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Q8L8

Protein Details
Accession G2Q8L8   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
3-23MELRKRKEAPAPPPPVRRKMTBasic
NLS Segment(s)
PositionSequence
6-25RKRKEAPAPPPPVRRKMTKT
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000866  AhpC/TSA  
IPR036249  Thioredoxin-like_sf  
IPR013766  Thioredoxin_domain  
Gene Ontology GO:0016209  F:antioxidant activity  
GO:0016491  F:oxidoreductase activity  
GO:0034599  P:cellular response to oxidative stress  
KEGG mtm:MYCTH_2314920  -  
Pfam View protein in Pfam  
PF00578  AhpC-TSA  
PROSITE View protein in PROSITE  
PS51352  THIOREDOXIN_2  
CDD cd03017  PRX_BCP  
Amino Acid Sequences MPMELRKRKEAPAPPPPVRRKMTKTAKTDTASKAKGDAEEKAAPVAASTNGSSSSGVPTVGDIINLDGFGGEIETNDGTKTTLKSLVDASKAGVVIFTYPKASTPGCTRQACLFRDSHEALTSASGLAIYGLSTDSPKANTTFKTKQKLPYPLLCDPQASLIGALGLKKQPRGTTRAVFVVDKAGKVLALQPGGPEATVAVVKKLVEELPSGSASAAPAEQKVKAEQVAEKKEEREEEKEKEEKEEKEKEEEKAQKKEEEEGAGAENKSEDAPKAEGEGQGESKSEGETKDKDETKAEGEAKATANGEEKKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.79
3 0.82
4 0.81
5 0.78
6 0.77
7 0.74
8 0.75
9 0.78
10 0.76
11 0.76
12 0.74
13 0.77
14 0.71
15 0.71
16 0.68
17 0.66
18 0.59
19 0.53
20 0.48
21 0.42
22 0.43
23 0.38
24 0.34
25 0.3
26 0.31
27 0.31
28 0.28
29 0.26
30 0.21
31 0.19
32 0.17
33 0.12
34 0.1
35 0.1
36 0.1
37 0.11
38 0.12
39 0.12
40 0.11
41 0.13
42 0.12
43 0.12
44 0.11
45 0.1
46 0.12
47 0.11
48 0.11
49 0.08
50 0.09
51 0.09
52 0.09
53 0.08
54 0.05
55 0.05
56 0.05
57 0.05
58 0.04
59 0.04
60 0.05
61 0.06
62 0.06
63 0.06
64 0.07
65 0.07
66 0.09
67 0.1
68 0.11
69 0.15
70 0.15
71 0.17
72 0.21
73 0.24
74 0.23
75 0.22
76 0.21
77 0.18
78 0.18
79 0.17
80 0.12
81 0.09
82 0.09
83 0.1
84 0.1
85 0.09
86 0.09
87 0.1
88 0.13
89 0.13
90 0.14
91 0.19
92 0.27
93 0.33
94 0.34
95 0.35
96 0.39
97 0.45
98 0.44
99 0.41
100 0.34
101 0.28
102 0.34
103 0.34
104 0.29
105 0.23
106 0.21
107 0.18
108 0.18
109 0.16
110 0.09
111 0.07
112 0.06
113 0.04
114 0.04
115 0.04
116 0.03
117 0.03
118 0.03
119 0.03
120 0.04
121 0.05
122 0.05
123 0.06
124 0.08
125 0.09
126 0.11
127 0.14
128 0.21
129 0.29
130 0.35
131 0.41
132 0.44
133 0.49
134 0.54
135 0.6
136 0.57
137 0.55
138 0.55
139 0.52
140 0.51
141 0.44
142 0.37
143 0.29
144 0.26
145 0.2
146 0.13
147 0.09
148 0.06
149 0.06
150 0.06
151 0.06
152 0.06
153 0.08
154 0.09
155 0.11
156 0.12
157 0.16
158 0.19
159 0.24
160 0.28
161 0.28
162 0.3
163 0.31
164 0.31
165 0.27
166 0.25
167 0.27
168 0.22
169 0.19
170 0.17
171 0.14
172 0.12
173 0.12
174 0.14
175 0.1
176 0.09
177 0.1
178 0.09
179 0.1
180 0.1
181 0.1
182 0.07
183 0.05
184 0.05
185 0.06
186 0.06
187 0.06
188 0.07
189 0.07
190 0.07
191 0.09
192 0.08
193 0.08
194 0.09
195 0.1
196 0.11
197 0.12
198 0.12
199 0.1
200 0.1
201 0.09
202 0.09
203 0.08
204 0.07
205 0.08
206 0.09
207 0.1
208 0.11
209 0.13
210 0.14
211 0.15
212 0.16
213 0.19
214 0.27
215 0.32
216 0.34
217 0.35
218 0.35
219 0.37
220 0.4
221 0.39
222 0.38
223 0.38
224 0.39
225 0.44
226 0.48
227 0.46
228 0.48
229 0.5
230 0.47
231 0.49
232 0.53
233 0.49
234 0.52
235 0.55
236 0.51
237 0.55
238 0.59
239 0.59
240 0.59
241 0.6
242 0.56
243 0.54
244 0.56
245 0.5
246 0.44
247 0.37
248 0.3
249 0.29
250 0.28
251 0.26
252 0.2
253 0.17
254 0.14
255 0.14
256 0.14
257 0.12
258 0.12
259 0.14
260 0.14
261 0.17
262 0.19
263 0.2
264 0.2
265 0.23
266 0.21
267 0.2
268 0.21
269 0.18
270 0.16
271 0.16
272 0.16
273 0.15
274 0.19
275 0.21
276 0.25
277 0.34
278 0.37
279 0.38
280 0.39
281 0.39
282 0.37
283 0.42
284 0.39
285 0.32
286 0.3
287 0.31
288 0.3
289 0.3
290 0.27
291 0.21
292 0.26
293 0.3