Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Q4I7

Protein Details
Accession G2Q4I7    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
71-90VLAHGPGRRRWRRRIRGGGGBasic
NLS Segment(s)
PositionSequence
68-97VGRVLAHGPGRRRWRRRIRGGGGGGRRLGR
Subcellular Location(s) mito 15, extr 8, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
KEGG mtm:MYCTH_2122535  -  
Amino Acid Sequences MVVCQLLLVSLKPGISVPAFLRTLSRAGATSAGHLLAFRPGKKEQYKQYGAEFARRVGSLHGGRVKLVGRVLAHGPGRRRWRRRIRGGGGGGRRLGRDRLITCTTRPSGTCEDYQEANRRYRLGALGDTFVFCCQEMDGDGELAAAAAIAKPGSSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.14
4 0.13
5 0.19
6 0.19
7 0.19
8 0.21
9 0.2
10 0.21
11 0.19
12 0.18
13 0.13
14 0.13
15 0.16
16 0.14
17 0.14
18 0.13
19 0.13
20 0.11
21 0.11
22 0.1
23 0.14
24 0.17
25 0.17
26 0.2
27 0.22
28 0.31
29 0.37
30 0.44
31 0.46
32 0.52
33 0.56
34 0.54
35 0.54
36 0.54
37 0.49
38 0.48
39 0.41
40 0.32
41 0.29
42 0.27
43 0.25
44 0.17
45 0.23
46 0.17
47 0.2
48 0.23
49 0.21
50 0.21
51 0.22
52 0.22
53 0.17
54 0.16
55 0.14
56 0.1
57 0.12
58 0.12
59 0.14
60 0.16
61 0.17
62 0.19
63 0.23
64 0.33
65 0.4
66 0.45
67 0.52
68 0.61
69 0.69
70 0.77
71 0.81
72 0.76
73 0.76
74 0.75
75 0.72
76 0.63
77 0.56
78 0.47
79 0.37
80 0.33
81 0.26
82 0.22
83 0.18
84 0.19
85 0.19
86 0.23
87 0.27
88 0.28
89 0.27
90 0.32
91 0.31
92 0.28
93 0.28
94 0.27
95 0.28
96 0.29
97 0.31
98 0.28
99 0.29
100 0.3
101 0.34
102 0.37
103 0.36
104 0.37
105 0.37
106 0.34
107 0.32
108 0.32
109 0.31
110 0.25
111 0.25
112 0.22
113 0.23
114 0.22
115 0.22
116 0.2
117 0.17
118 0.15
119 0.11
120 0.1
121 0.08
122 0.08
123 0.08
124 0.11
125 0.12
126 0.11
127 0.11
128 0.1
129 0.1
130 0.09
131 0.07
132 0.04
133 0.03
134 0.03
135 0.04
136 0.04