Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QL63

Protein Details
Accession G2QL63   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
383-403ASDKKRKKLTAGAKSRPPRVEBasic
NLS Segment(s)
PositionSequence
278-327RRALLRAKLKERDRKLSKQKGGWFWWLPGRRVADKPPATSHEKAHHPRHA
385-401DKKRKKLTAGAKSRPPR
Subcellular Location(s) cyto 8.5, mito 7, cyto_nucl 7, nucl 4.5, pero 2, plas 1, extr 1, E.R. 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR005605  Spo7  
Gene Ontology GO:0016020  C:membrane  
GO:0019888  F:protein phosphatase regulator activity  
KEGG mtm:MYCTH_2310201  -  
Pfam View protein in Pfam  
PF03907  Spo7  
Amino Acid Sequences MADSLDSIVKGAPVTLPGQDPAKVVGGTTPIGSSDSPPASGKIGDPLSHTPSSPSMIYLNLLILEASLRAQYLELRARRRHHTFFLTLLTLWTAFFGYALFFAPREDGRGVGGSVYWVIETTEHMCFLAGIITGLLVWATGIWERGVRWPRRWLAVSNRGLRGFNCKLVVLKRPWWKEALSTIGWFLTYGLFSDNGSSYRWVEPSLLREVDRELNLTRESHPAVHVNNRDEERGGHEEDLAPGGDYVKLLLLAKPFSPTFRENWEFYRAEYWEKENERRALLRAKLKERDRKLSKQKGGWFWWLPGRRVADKPPATSHEKAHHPRHAAVAGEHRRTRSGSASTRRGSVSSGMSGMHGPRTPASKIDGEDHPGIARKGSSSSDASDKKRKKLTAGAKSRPPRVESRSATPETPSPLAKESTPKADSQTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.15
4 0.17
5 0.19
6 0.2
7 0.2
8 0.2
9 0.22
10 0.19
11 0.18
12 0.17
13 0.18
14 0.17
15 0.16
16 0.14
17 0.11
18 0.13
19 0.14
20 0.14
21 0.18
22 0.18
23 0.2
24 0.21
25 0.22
26 0.22
27 0.22
28 0.21
29 0.21
30 0.22
31 0.21
32 0.25
33 0.28
34 0.32
35 0.32
36 0.32
37 0.27
38 0.27
39 0.29
40 0.25
41 0.22
42 0.17
43 0.17
44 0.17
45 0.15
46 0.14
47 0.1
48 0.1
49 0.08
50 0.07
51 0.06
52 0.06
53 0.06
54 0.06
55 0.05
56 0.05
57 0.06
58 0.08
59 0.13
60 0.21
61 0.27
62 0.34
63 0.41
64 0.47
65 0.55
66 0.61
67 0.61
68 0.6
69 0.61
70 0.56
71 0.52
72 0.5
73 0.44
74 0.36
75 0.3
76 0.24
77 0.18
78 0.15
79 0.12
80 0.08
81 0.06
82 0.06
83 0.06
84 0.05
85 0.05
86 0.07
87 0.07
88 0.07
89 0.07
90 0.1
91 0.1
92 0.13
93 0.13
94 0.12
95 0.13
96 0.14
97 0.14
98 0.11
99 0.11
100 0.08
101 0.08
102 0.07
103 0.06
104 0.05
105 0.05
106 0.05
107 0.07
108 0.09
109 0.09
110 0.1
111 0.1
112 0.09
113 0.09
114 0.09
115 0.09
116 0.06
117 0.05
118 0.05
119 0.04
120 0.04
121 0.04
122 0.04
123 0.02
124 0.02
125 0.02
126 0.03
127 0.03
128 0.04
129 0.05
130 0.06
131 0.07
132 0.14
133 0.23
134 0.27
135 0.31
136 0.38
137 0.4
138 0.45
139 0.47
140 0.44
141 0.46
142 0.52
143 0.55
144 0.53
145 0.54
146 0.49
147 0.48
148 0.43
149 0.42
150 0.34
151 0.29
152 0.25
153 0.22
154 0.23
155 0.25
156 0.32
157 0.27
158 0.32
159 0.38
160 0.4
161 0.41
162 0.41
163 0.38
164 0.34
165 0.33
166 0.3
167 0.23
168 0.2
169 0.19
170 0.17
171 0.16
172 0.13
173 0.1
174 0.06
175 0.05
176 0.05
177 0.05
178 0.05
179 0.06
180 0.07
181 0.07
182 0.07
183 0.08
184 0.09
185 0.1
186 0.11
187 0.12
188 0.11
189 0.12
190 0.13
191 0.15
192 0.18
193 0.17
194 0.16
195 0.16
196 0.18
197 0.19
198 0.18
199 0.16
200 0.13
201 0.14
202 0.14
203 0.15
204 0.14
205 0.14
206 0.15
207 0.14
208 0.15
209 0.15
210 0.16
211 0.22
212 0.24
213 0.23
214 0.26
215 0.26
216 0.26
217 0.23
218 0.22
219 0.21
220 0.2
221 0.2
222 0.16
223 0.16
224 0.15
225 0.15
226 0.16
227 0.1
228 0.07
229 0.06
230 0.06
231 0.06
232 0.05
233 0.05
234 0.04
235 0.05
236 0.05
237 0.07
238 0.08
239 0.08
240 0.09
241 0.11
242 0.12
243 0.12
244 0.16
245 0.16
246 0.17
247 0.24
248 0.27
249 0.26
250 0.29
251 0.35
252 0.31
253 0.3
254 0.32
255 0.25
256 0.25
257 0.25
258 0.25
259 0.25
260 0.3
261 0.34
262 0.36
263 0.37
264 0.36
265 0.36
266 0.37
267 0.37
268 0.38
269 0.41
270 0.42
271 0.47
272 0.53
273 0.6
274 0.66
275 0.65
276 0.7
277 0.69
278 0.73
279 0.77
280 0.79
281 0.78
282 0.76
283 0.77
284 0.74
285 0.71
286 0.69
287 0.6
288 0.52
289 0.53
290 0.5
291 0.44
292 0.41
293 0.41
294 0.38
295 0.39
296 0.42
297 0.44
298 0.43
299 0.44
300 0.44
301 0.44
302 0.47
303 0.46
304 0.45
305 0.42
306 0.48
307 0.54
308 0.57
309 0.58
310 0.56
311 0.55
312 0.55
313 0.5
314 0.42
315 0.36
316 0.38
317 0.39
318 0.42
319 0.43
320 0.39
321 0.39
322 0.39
323 0.39
324 0.35
325 0.35
326 0.38
327 0.44
328 0.51
329 0.51
330 0.53
331 0.51
332 0.46
333 0.39
334 0.34
335 0.28
336 0.21
337 0.2
338 0.17
339 0.17
340 0.18
341 0.18
342 0.18
343 0.15
344 0.15
345 0.17
346 0.21
347 0.21
348 0.22
349 0.25
350 0.25
351 0.26
352 0.3
353 0.3
354 0.31
355 0.32
356 0.3
357 0.28
358 0.27
359 0.26
360 0.22
361 0.2
362 0.16
363 0.17
364 0.18
365 0.21
366 0.2
367 0.22
368 0.3
369 0.37
370 0.42
371 0.5
372 0.55
373 0.6
374 0.66
375 0.66
376 0.63
377 0.67
378 0.71
379 0.71
380 0.75
381 0.75
382 0.77
383 0.82
384 0.84
385 0.79
386 0.73
387 0.7
388 0.67
389 0.69
390 0.64
391 0.65
392 0.65
393 0.64
394 0.6
395 0.55
396 0.51
397 0.47
398 0.45
399 0.38
400 0.33
401 0.32
402 0.33
403 0.33
404 0.37
405 0.36
406 0.41
407 0.41
408 0.4