Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2QGL2

Protein Details
Accession G2QGL2    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MESKWDHKNKNTYNHKNKNTYNTGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 8.5, nucl 8, mito 8, cyto 7, pero 3
Family & Domain DBs
KEGG mtm:MYCTH_2063966  -  
Amino Acid Sequences MESKWDHKNKNTYNHKNKNTYNTGDSLVVTDPTTNPALASLSRGERTGSRVLWQVWSYVAVRRSGKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.85
4 0.82
5 0.81
6 0.76
7 0.69
8 0.61
9 0.52
10 0.45
11 0.37
12 0.32
13 0.24
14 0.18
15 0.14
16 0.11
17 0.09
18 0.07
19 0.09
20 0.1
21 0.08
22 0.07
23 0.07
24 0.08
25 0.08
26 0.09
27 0.09
28 0.11
29 0.12
30 0.12
31 0.13
32 0.13
33 0.18
34 0.2
35 0.19
36 0.19
37 0.23
38 0.23
39 0.27
40 0.26
41 0.23
42 0.19
43 0.21
44 0.2
45 0.21
46 0.23
47 0.24