Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Q340

Protein Details
Accession G2Q340   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
58-80NRNSVQDKRSKIRQKWKEIDENSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 6, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
KEGG mtm:MYCTH_98929  -  
Pfam View protein in Pfam  
PF08583  Cmc1  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MHPLLFTKDNAGCEQLMAALEECHAKGFIWKAAGMCNDAKQQLTECLRAERLKNQSLNRNSVQDKRSKIRQKWKEIDENS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.14
3 0.12
4 0.1
5 0.09
6 0.07
7 0.07
8 0.08
9 0.08
10 0.08
11 0.08
12 0.07
13 0.09
14 0.11
15 0.12
16 0.12
17 0.13
18 0.13
19 0.15
20 0.16
21 0.16
22 0.15
23 0.15
24 0.15
25 0.15
26 0.15
27 0.13
28 0.13
29 0.16
30 0.18
31 0.18
32 0.17
33 0.19
34 0.22
35 0.24
36 0.25
37 0.26
38 0.3
39 0.34
40 0.38
41 0.41
42 0.48
43 0.51
44 0.55
45 0.51
46 0.51
47 0.49
48 0.51
49 0.5
50 0.48
51 0.5
52 0.51
53 0.59
54 0.63
55 0.69
56 0.72
57 0.78
58 0.82
59 0.85
60 0.86