Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QNH1

Protein Details
Accession G2QNH1    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-30AAAAGAKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
8-24GAKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 10.5, cyto_nucl 9.333, nucl 7, mito_nucl 6.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG mtm:MYCTH_71631  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAAAGAKKQKKKWSKGKVKDKAQHAVILDKATSDKLYKDVQSYRLVTVATLVDRLKINGSLARKCLKDLEEKGQIKQVVGHSKMKIYTRAVGAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.77
3 0.79
4 0.83
5 0.87
6 0.92
7 0.92
8 0.92
9 0.89
10 0.85
11 0.81
12 0.72
13 0.65
14 0.55
15 0.48
16 0.38
17 0.32
18 0.25
19 0.18
20 0.16
21 0.13
22 0.13
23 0.1
24 0.09
25 0.11
26 0.14
27 0.15
28 0.18
29 0.2
30 0.23
31 0.26
32 0.27
33 0.25
34 0.23
35 0.22
36 0.17
37 0.16
38 0.13
39 0.08
40 0.09
41 0.08
42 0.09
43 0.09
44 0.1
45 0.09
46 0.09
47 0.1
48 0.12
49 0.16
50 0.17
51 0.2
52 0.24
53 0.24
54 0.24
55 0.27
56 0.26
57 0.31
58 0.33
59 0.38
60 0.43
61 0.45
62 0.45
63 0.47
64 0.46
65 0.37
66 0.37
67 0.36
68 0.34
69 0.37
70 0.41
71 0.37
72 0.4
73 0.44
74 0.43
75 0.42
76 0.37
77 0.39
78 0.35