Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QBA5

Protein Details
Accession G2QBA5   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-41LKLKGGAGVTKKKKKKDKGKTTDLEKNLBasic
NLS Segment(s)
PositionSequence
13-33PLKLKGGAGVTKKKKKKDKGK
115-130VKRKRLKELAESKRIR
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
KEGG mtm:MYCTH_2314827  -  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPSDEYTTVGRGPLKLKGGAGVTKKKKKKDKGKTTDLEKNLSTGGGDGSRDSSERALVPTEKEGTPGTGADKGGGGGEGTPPEARGGELQKEDGPPASAVEDDYKTEAERRFAEVKRKRLKELAESKRIRPELLKTHKQRVEELNAHLARLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.26
4 0.26
5 0.28
6 0.31
7 0.36
8 0.4
9 0.47
10 0.55
11 0.62
12 0.69
13 0.76
14 0.81
15 0.85
16 0.86
17 0.87
18 0.87
19 0.91
20 0.9
21 0.88
22 0.86
23 0.78
24 0.71
25 0.6
26 0.5
27 0.4
28 0.31
29 0.23
30 0.14
31 0.12
32 0.09
33 0.09
34 0.08
35 0.09
36 0.1
37 0.1
38 0.11
39 0.1
40 0.1
41 0.1
42 0.11
43 0.12
44 0.12
45 0.13
46 0.15
47 0.17
48 0.16
49 0.17
50 0.16
51 0.15
52 0.14
53 0.13
54 0.12
55 0.11
56 0.11
57 0.1
58 0.09
59 0.08
60 0.08
61 0.07
62 0.06
63 0.04
64 0.04
65 0.04
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.07
73 0.09
74 0.11
75 0.11
76 0.12
77 0.13
78 0.14
79 0.14
80 0.12
81 0.11
82 0.09
83 0.09
84 0.08
85 0.07
86 0.07
87 0.09
88 0.1
89 0.09
90 0.1
91 0.1
92 0.1
93 0.14
94 0.15
95 0.16
96 0.17
97 0.21
98 0.27
99 0.3
100 0.4
101 0.44
102 0.53
103 0.59
104 0.62
105 0.61
106 0.6
107 0.61
108 0.61
109 0.64
110 0.63
111 0.63
112 0.63
113 0.63
114 0.66
115 0.63
116 0.54
117 0.46
118 0.44
119 0.45
120 0.51
121 0.58
122 0.56
123 0.65
124 0.67
125 0.66
126 0.64
127 0.6
128 0.6
129 0.55
130 0.52
131 0.52
132 0.49
133 0.47
134 0.41
135 0.34
136 0.26
137 0.22
138 0.24
139 0.19
140 0.22
141 0.26
142 0.28
143 0.3