Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Q398

Protein Details
Accession G2Q398   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
407-446DWLIKRLSDKYKKDKGHWSHDLWKKMKGRDNKGRREKVELBasic
NLS Segment(s)
PositionSequence
419-423KDKGH
425-443SHDLWKKMKGRDNKGRREK
Subcellular Location(s) nucl 8, cyto 7, cyto_mito 7, mito 5, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011989  ARM-like  
KEGG mtm:MYCTH_2296861  -  
Amino Acid Sequences MVEYRLKMLPLNLLALMGLLARGASASSSAAGESPSSASPSADVELICHTDNPAECYPKVFQATDEFQVVHPDQELPMGLHVRLNVYTGVKEAKLNVPDEHNPALEGLPVDSSVVVVEREKAEEQAKPPPNAPSYDPAGSVKKPKSADPEEGSAFYKSLTILKKGLDVDGALEMLEEISHDIYYGLKIAEDYDTIHELFCLSTRDPEDETALGRARIASLILASTLQNNPKALAEIESHWAKLAPSTCRGGDPLETSIFALLPTTSKGSAQAHGQTQTQAEPAVTPNPGLTKARISLLTSLLKSPLFRTAFLSPSQPASAGGASHILRILTTPYSGGQQQQAEQNKDEEWNSAQRRAAILLVDTFLDADMGATVGQWPTKAQLTDKECAALFDGNPESEGREEECADWLIKRLSDKYKKDKGHWSHDLWKKMKGRDNKGRREKVEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.15
4 0.08
5 0.06
6 0.04
7 0.04
8 0.03
9 0.04
10 0.04
11 0.04
12 0.05
13 0.05
14 0.06
15 0.07
16 0.07
17 0.08
18 0.08
19 0.08
20 0.09
21 0.1
22 0.1
23 0.12
24 0.13
25 0.12
26 0.13
27 0.14
28 0.14
29 0.14
30 0.13
31 0.12
32 0.14
33 0.16
34 0.16
35 0.14
36 0.14
37 0.16
38 0.17
39 0.22
40 0.24
41 0.27
42 0.26
43 0.3
44 0.31
45 0.33
46 0.36
47 0.3
48 0.27
49 0.3
50 0.34
51 0.32
52 0.32
53 0.27
54 0.24
55 0.3
56 0.28
57 0.22
58 0.18
59 0.16
60 0.15
61 0.15
62 0.16
63 0.1
64 0.13
65 0.14
66 0.13
67 0.13
68 0.14
69 0.15
70 0.14
71 0.15
72 0.14
73 0.14
74 0.14
75 0.14
76 0.16
77 0.15
78 0.16
79 0.17
80 0.21
81 0.23
82 0.25
83 0.25
84 0.28
85 0.3
86 0.34
87 0.33
88 0.27
89 0.24
90 0.23
91 0.21
92 0.17
93 0.14
94 0.09
95 0.08
96 0.08
97 0.07
98 0.06
99 0.06
100 0.05
101 0.05
102 0.06
103 0.06
104 0.08
105 0.08
106 0.11
107 0.12
108 0.14
109 0.16
110 0.19
111 0.21
112 0.29
113 0.34
114 0.33
115 0.35
116 0.38
117 0.38
118 0.37
119 0.37
120 0.31
121 0.3
122 0.29
123 0.29
124 0.26
125 0.28
126 0.28
127 0.33
128 0.31
129 0.32
130 0.32
131 0.34
132 0.4
133 0.41
134 0.46
135 0.42
136 0.44
137 0.4
138 0.4
139 0.38
140 0.29
141 0.24
142 0.17
143 0.14
144 0.1
145 0.14
146 0.14
147 0.15
148 0.16
149 0.17
150 0.2
151 0.2
152 0.2
153 0.15
154 0.13
155 0.12
156 0.1
157 0.1
158 0.06
159 0.05
160 0.05
161 0.04
162 0.04
163 0.03
164 0.03
165 0.03
166 0.03
167 0.04
168 0.04
169 0.04
170 0.05
171 0.05
172 0.05
173 0.04
174 0.05
175 0.05
176 0.06
177 0.06
178 0.07
179 0.08
180 0.09
181 0.09
182 0.09
183 0.08
184 0.08
185 0.08
186 0.08
187 0.09
188 0.07
189 0.1
190 0.11
191 0.13
192 0.14
193 0.15
194 0.15
195 0.13
196 0.13
197 0.13
198 0.12
199 0.1
200 0.1
201 0.09
202 0.08
203 0.07
204 0.07
205 0.04
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.06
212 0.08
213 0.09
214 0.1
215 0.11
216 0.11
217 0.11
218 0.12
219 0.1
220 0.11
221 0.1
222 0.1
223 0.14
224 0.14
225 0.14
226 0.13
227 0.13
228 0.11
229 0.12
230 0.15
231 0.13
232 0.15
233 0.18
234 0.18
235 0.18
236 0.19
237 0.18
238 0.15
239 0.15
240 0.15
241 0.13
242 0.13
243 0.12
244 0.11
245 0.1
246 0.09
247 0.07
248 0.05
249 0.05
250 0.05
251 0.07
252 0.07
253 0.07
254 0.1
255 0.12
256 0.13
257 0.15
258 0.18
259 0.19
260 0.21
261 0.21
262 0.19
263 0.19
264 0.18
265 0.15
266 0.12
267 0.1
268 0.09
269 0.09
270 0.11
271 0.1
272 0.09
273 0.09
274 0.1
275 0.13
276 0.13
277 0.13
278 0.14
279 0.15
280 0.17
281 0.17
282 0.17
283 0.17
284 0.2
285 0.23
286 0.2
287 0.2
288 0.2
289 0.19
290 0.18
291 0.17
292 0.21
293 0.19
294 0.19
295 0.23
296 0.24
297 0.26
298 0.26
299 0.28
300 0.21
301 0.22
302 0.21
303 0.17
304 0.15
305 0.14
306 0.14
307 0.11
308 0.1
309 0.12
310 0.12
311 0.12
312 0.12
313 0.1
314 0.09
315 0.1
316 0.12
317 0.09
318 0.09
319 0.09
320 0.09
321 0.12
322 0.13
323 0.15
324 0.17
325 0.17
326 0.19
327 0.26
328 0.33
329 0.34
330 0.34
331 0.34
332 0.31
333 0.32
334 0.3
335 0.25
336 0.21
337 0.27
338 0.29
339 0.32
340 0.32
341 0.31
342 0.31
343 0.3
344 0.28
345 0.2
346 0.17
347 0.14
348 0.13
349 0.12
350 0.11
351 0.09
352 0.08
353 0.07
354 0.05
355 0.04
356 0.04
357 0.04
358 0.04
359 0.04
360 0.05
361 0.06
362 0.06
363 0.07
364 0.07
365 0.1
366 0.14
367 0.16
368 0.18
369 0.26
370 0.31
371 0.34
372 0.34
373 0.34
374 0.3
375 0.29
376 0.29
377 0.22
378 0.17
379 0.19
380 0.2
381 0.18
382 0.19
383 0.18
384 0.17
385 0.16
386 0.18
387 0.14
388 0.15
389 0.16
390 0.16
391 0.18
392 0.18
393 0.18
394 0.17
395 0.19
396 0.19
397 0.2
398 0.23
399 0.28
400 0.37
401 0.46
402 0.55
403 0.62
404 0.69
405 0.74
406 0.77
407 0.81
408 0.8
409 0.8
410 0.79
411 0.76
412 0.77
413 0.77
414 0.8
415 0.72
416 0.72
417 0.69
418 0.69
419 0.7
420 0.71
421 0.74
422 0.75
423 0.83
424 0.85
425 0.89
426 0.9