Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QPZ9

Protein Details
Accession G2QPZ9   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
46-73YIHYATMKPEQKKKKEKKGEKKGPEQKRBasic
NLS Segment(s)
PositionSequence
55-73EQKKKKEKKGEKKGPEQKR
Subcellular Location(s) E.R. 8, mito 7, plas 4, cyto 3, nucl 2, cyto_pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG mtm:MYCTH_57543  -  
Amino Acid Sequences MGQFDWFGKIGATPEAVAVLNDQPHLFTILIIVLIALILQCVLHWYIHYATMKPEQKKKKEKKGEKKGPEQKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.1
4 0.09
5 0.09
6 0.1
7 0.1
8 0.1
9 0.1
10 0.09
11 0.09
12 0.11
13 0.1
14 0.08
15 0.07
16 0.07
17 0.07
18 0.06
19 0.05
20 0.03
21 0.03
22 0.03
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.03
29 0.04
30 0.04
31 0.04
32 0.07
33 0.08
34 0.13
35 0.14
36 0.14
37 0.16
38 0.25
39 0.32
40 0.36
41 0.45
42 0.51
43 0.6
44 0.71
45 0.78
46 0.81
47 0.85
48 0.9
49 0.93
50 0.94
51 0.95
52 0.94
53 0.95