Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Q5C1

Protein Details
Accession G2Q5C1    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAMTRNKNKNKNKTTRSTKLNTTSHydrophilic
74-96RSSRSEKPSGRRRRRSVPPKGSSBasic
NLS Segment(s)
PositionSequence
76-93SRSEKPSGRRRRRSVPPK
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
KEGG mtm:MYCTH_91253  -  
Amino Acid Sequences MAMTRNKNKNKNKTTRSTKLNTTSTDSTYDRASREVVIWDTAEPTRSRDSSATRPRSSGSSSPSDSSSLRTASRSSRSEKPSGRRRRRSVPPKGSSVAPTVGSRGSTGAAAAGSDSGSGSGPGRTSAPSPSARGSGSGGLSLTETNVRRTSDFYEYLKGERDKAGEMAGPSGRTAFLLDTLVDVDSKLSGERW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.89
3 0.88
4 0.83
5 0.81
6 0.79
7 0.75
8 0.67
9 0.64
10 0.58
11 0.51
12 0.5
13 0.42
14 0.35
15 0.33
16 0.32
17 0.26
18 0.24
19 0.23
20 0.19
21 0.19
22 0.21
23 0.18
24 0.17
25 0.17
26 0.15
27 0.17
28 0.16
29 0.17
30 0.15
31 0.16
32 0.2
33 0.19
34 0.22
35 0.23
36 0.28
37 0.36
38 0.46
39 0.51
40 0.47
41 0.48
42 0.47
43 0.47
44 0.46
45 0.4
46 0.34
47 0.31
48 0.32
49 0.32
50 0.32
51 0.31
52 0.26
53 0.25
54 0.22
55 0.18
56 0.17
57 0.17
58 0.18
59 0.2
60 0.27
61 0.27
62 0.3
63 0.36
64 0.4
65 0.46
66 0.5
67 0.55
68 0.59
69 0.67
70 0.73
71 0.75
72 0.76
73 0.78
74 0.83
75 0.84
76 0.85
77 0.84
78 0.77
79 0.72
80 0.67
81 0.59
82 0.5
83 0.42
84 0.32
85 0.22
86 0.18
87 0.14
88 0.13
89 0.12
90 0.1
91 0.09
92 0.07
93 0.06
94 0.06
95 0.05
96 0.05
97 0.04
98 0.04
99 0.04
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.04
106 0.05
107 0.05
108 0.05
109 0.06
110 0.07
111 0.08
112 0.09
113 0.1
114 0.14
115 0.16
116 0.18
117 0.19
118 0.2
119 0.19
120 0.19
121 0.19
122 0.17
123 0.15
124 0.14
125 0.12
126 0.1
127 0.11
128 0.09
129 0.09
130 0.11
131 0.12
132 0.15
133 0.18
134 0.19
135 0.19
136 0.22
137 0.26
138 0.26
139 0.3
140 0.29
141 0.31
142 0.32
143 0.33
144 0.37
145 0.34
146 0.3
147 0.29
148 0.28
149 0.25
150 0.24
151 0.24
152 0.19
153 0.19
154 0.2
155 0.19
156 0.18
157 0.16
158 0.16
159 0.15
160 0.13
161 0.13
162 0.1
163 0.09
164 0.1
165 0.1
166 0.1
167 0.11
168 0.11
169 0.1
170 0.09
171 0.08
172 0.07
173 0.08