Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Q2Q1

Protein Details
Accession G2Q2Q1    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
14-43LNKGHKTTARVNKPRPSRQKGKLSNRTQFVHydrophilic
63-87LLRNGKDKRARKFAKKKLGTFNRAKBasic
NLS Segment(s)
PositionSequence
18-35HKTTARVNKPRPSRQKGK
66-86NGKDKRARKFAKKKLGTFNRA
Subcellular Location(s) nucl 13, mito 11, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mtm:MYCTH_2294821  -  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAKETERTGLARGLNKGHKTTARVNKPRPSRQKGKLSNRTQFVRSLVKEVVGLAPYERRVIELLRNGKDKRARKFAKKKLGTFNRAKVKIEELQRIITESRRAGGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.42
4 0.43
5 0.43
6 0.43
7 0.5
8 0.53
9 0.57
10 0.63
11 0.68
12 0.71
13 0.77
14 0.83
15 0.83
16 0.82
17 0.8
18 0.8
19 0.83
20 0.85
21 0.86
22 0.87
23 0.85
24 0.83
25 0.79
26 0.73
27 0.64
28 0.55
29 0.48
30 0.44
31 0.36
32 0.33
33 0.27
34 0.24
35 0.22
36 0.2
37 0.17
38 0.11
39 0.1
40 0.07
41 0.08
42 0.08
43 0.09
44 0.08
45 0.08
46 0.08
47 0.09
48 0.13
49 0.19
50 0.24
51 0.27
52 0.33
53 0.33
54 0.38
55 0.45
56 0.48
57 0.49
58 0.54
59 0.58
60 0.63
61 0.74
62 0.78
63 0.81
64 0.82
65 0.82
66 0.82
67 0.85
68 0.82
69 0.79
70 0.78
71 0.78
72 0.72
73 0.68
74 0.59
75 0.55
76 0.53
77 0.51
78 0.5
79 0.42
80 0.43
81 0.41
82 0.41
83 0.37
84 0.35
85 0.34
86 0.27