Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0V461

Protein Details
Accession Q0V461    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
19-38QASSAPKSKKRNPSTPHIIHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 9, mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020347  Pop8  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0000172  C:ribonuclease MRP complex  
GO:0034965  P:intronic box C/D RNA processing  
GO:0006379  P:mRNA cleavage  
GO:0000294  P:nuclear-transcribed mRNA catabolic process, RNase MRP-dependent  
GO:0090502  P:RNA phosphodiester bond hydrolysis, endonucleolytic  
GO:0008033  P:tRNA processing  
KEGG pno:SNOG_01203  -  
Amino Acid Sequences MAPLPLSTTAPSTSTPIEQASSAPKSKKRNPSTPHIIHTSTLRHPHYTYFHLTLTPSSSSSSSTTTNNKPTALDPLLISQLLTQALSSYLGLTGAAIPVDILKSEGREVWIRVPARDARGVRAGLSSWCGKVGGAGTRDLRISRRVRTWKVHARVAWTGLCQDAKWGSVMVIRLSGRGQEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.19
4 0.19
5 0.17
6 0.18
7 0.21
8 0.25
9 0.28
10 0.33
11 0.38
12 0.46
13 0.55
14 0.64
15 0.67
16 0.72
17 0.72
18 0.76
19 0.8
20 0.77
21 0.73
22 0.67
23 0.6
24 0.51
25 0.49
26 0.44
27 0.38
28 0.4
29 0.37
30 0.34
31 0.34
32 0.37
33 0.38
34 0.37
35 0.37
36 0.32
37 0.3
38 0.28
39 0.28
40 0.24
41 0.23
42 0.19
43 0.15
44 0.13
45 0.13
46 0.14
47 0.15
48 0.16
49 0.15
50 0.18
51 0.23
52 0.26
53 0.31
54 0.31
55 0.3
56 0.28
57 0.27
58 0.3
59 0.26
60 0.22
61 0.17
62 0.16
63 0.17
64 0.15
65 0.15
66 0.08
67 0.08
68 0.07
69 0.07
70 0.05
71 0.04
72 0.05
73 0.05
74 0.05
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.04
89 0.04
90 0.05
91 0.06
92 0.06
93 0.09
94 0.1
95 0.11
96 0.13
97 0.19
98 0.19
99 0.19
100 0.22
101 0.23
102 0.24
103 0.29
104 0.27
105 0.24
106 0.28
107 0.28
108 0.25
109 0.23
110 0.21
111 0.15
112 0.17
113 0.16
114 0.11
115 0.12
116 0.11
117 0.1
118 0.11
119 0.12
120 0.14
121 0.14
122 0.17
123 0.18
124 0.19
125 0.2
126 0.21
127 0.21
128 0.24
129 0.27
130 0.3
131 0.38
132 0.46
133 0.52
134 0.59
135 0.66
136 0.69
137 0.71
138 0.72
139 0.64
140 0.62
141 0.59
142 0.55
143 0.46
144 0.37
145 0.32
146 0.28
147 0.27
148 0.2
149 0.2
150 0.18
151 0.16
152 0.16
153 0.15
154 0.13
155 0.15
156 0.17
157 0.14
158 0.18
159 0.18
160 0.18
161 0.18