Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2PZT3

Protein Details
Accession G2PZT3    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MADRIPRNRRDLKRERHAIABasic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 10, plas 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG mtm:MYCTH_2294124  -  
Amino Acid Sequences MADRIPRNRRDLKRERHAIAIKIEREGYEVAMPCERCWNAKPRKRCVMMEGLNKCQNCVRMGKKCSSPNVTDAYRFLVVFLCSLGLLTVLVLSNLSEQEKVSKEIAETEALLAQMLSRLSRLRRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.78
3 0.78
4 0.74
5 0.68
6 0.66
7 0.63
8 0.54
9 0.47
10 0.45
11 0.35
12 0.32
13 0.28
14 0.21
15 0.17
16 0.16
17 0.16
18 0.19
19 0.19
20 0.18
21 0.23
22 0.22
23 0.21
24 0.24
25 0.32
26 0.39
27 0.46
28 0.54
29 0.57
30 0.66
31 0.68
32 0.66
33 0.6
34 0.59
35 0.59
36 0.59
37 0.55
38 0.51
39 0.5
40 0.48
41 0.44
42 0.36
43 0.31
44 0.24
45 0.26
46 0.27
47 0.31
48 0.34
49 0.37
50 0.42
51 0.44
52 0.47
53 0.46
54 0.41
55 0.35
56 0.37
57 0.34
58 0.29
59 0.26
60 0.24
61 0.2
62 0.18
63 0.16
64 0.12
65 0.12
66 0.11
67 0.1
68 0.07
69 0.06
70 0.06
71 0.05
72 0.04
73 0.03
74 0.03
75 0.04
76 0.03
77 0.04
78 0.04
79 0.04
80 0.05
81 0.06
82 0.07
83 0.07
84 0.07
85 0.12
86 0.14
87 0.17
88 0.17
89 0.17
90 0.17
91 0.2
92 0.22
93 0.19
94 0.17
95 0.15
96 0.15
97 0.14
98 0.13
99 0.1
100 0.08
101 0.09
102 0.09
103 0.08
104 0.09
105 0.14