Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2QN69

Protein Details
Accession G2QN69    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
41-68TPPSSGPTPTQRQRHRHYKPRTCRICLEHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 23, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011016  Znf_RING-CH  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0016020  C:membrane  
GO:0008270  F:zinc ion binding  
KEGG mtm:MYCTH_2312751  -  
Pfam View protein in Pfam  
PF12906  RINGv  
PROSITE View protein in PROSITE  
PS51292  ZF_RING_CH  
CDD cd16495  RING_CH-C4HC3_MARCH  
Amino Acid Sequences MASEAFRPQWGWPSGVNSQANREATTPAVDEQTRRATSSSTPPSSGPTPTQRQRHRHYKPRTCRICLEVVYPTTVIDDSLAGRVFSSKARVRYVSEDPELGRLMSPCKCKGSQKYVHEGCLRAWRNAAPLSDRNYWRCPTCQFEYRLERLRWGRWLSSKVLRVTLTVAILVFTVFILGFIADPIIGFWEDPFGSLVGGLLDIDFDYDEPVLPDEGPGSWSLHFLKGFLSLGLLGFLKTMYFMSPWHWFNIRFGGYRRRRGAGRDRLEQINWGLVLVGVLTFLGATWKFVNHLMAKTLEKASDRVVDVQEDDPDDDEADDVPGAAAPETATNESKKDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.4
3 0.43
4 0.36
5 0.39
6 0.44
7 0.43
8 0.38
9 0.37
10 0.3
11 0.27
12 0.28
13 0.24
14 0.18
15 0.21
16 0.21
17 0.21
18 0.25
19 0.32
20 0.31
21 0.3
22 0.29
23 0.27
24 0.3
25 0.39
26 0.43
27 0.38
28 0.38
29 0.37
30 0.42
31 0.42
32 0.41
33 0.37
34 0.36
35 0.43
36 0.49
37 0.59
38 0.63
39 0.7
40 0.76
41 0.81
42 0.83
43 0.84
44 0.87
45 0.88
46 0.9
47 0.91
48 0.91
49 0.85
50 0.8
51 0.74
52 0.7
53 0.61
54 0.53
55 0.47
56 0.39
57 0.35
58 0.3
59 0.25
60 0.19
61 0.17
62 0.13
63 0.09
64 0.08
65 0.07
66 0.09
67 0.1
68 0.09
69 0.09
70 0.1
71 0.1
72 0.11
73 0.18
74 0.2
75 0.24
76 0.28
77 0.3
78 0.32
79 0.37
80 0.42
81 0.41
82 0.37
83 0.35
84 0.31
85 0.32
86 0.29
87 0.23
88 0.18
89 0.13
90 0.15
91 0.18
92 0.22
93 0.22
94 0.26
95 0.29
96 0.35
97 0.42
98 0.49
99 0.53
100 0.54
101 0.62
102 0.6
103 0.63
104 0.59
105 0.52
106 0.44
107 0.45
108 0.41
109 0.31
110 0.3
111 0.25
112 0.26
113 0.28
114 0.26
115 0.21
116 0.23
117 0.28
118 0.34
119 0.36
120 0.36
121 0.38
122 0.39
123 0.36
124 0.35
125 0.32
126 0.31
127 0.34
128 0.36
129 0.36
130 0.41
131 0.45
132 0.47
133 0.52
134 0.46
135 0.47
136 0.43
137 0.42
138 0.4
139 0.36
140 0.35
141 0.31
142 0.34
143 0.32
144 0.35
145 0.38
146 0.33
147 0.33
148 0.3
149 0.27
150 0.25
151 0.22
152 0.16
153 0.11
154 0.1
155 0.07
156 0.07
157 0.06
158 0.04
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.02
169 0.02
170 0.02
171 0.03
172 0.03
173 0.03
174 0.03
175 0.05
176 0.05
177 0.06
178 0.06
179 0.06
180 0.05
181 0.05
182 0.05
183 0.04
184 0.04
185 0.03
186 0.03
187 0.03
188 0.03
189 0.03
190 0.03
191 0.03
192 0.03
193 0.04
194 0.04
195 0.04
196 0.05
197 0.05
198 0.05
199 0.05
200 0.05
201 0.05
202 0.06
203 0.07
204 0.08
205 0.07
206 0.1
207 0.11
208 0.13
209 0.13
210 0.13
211 0.12
212 0.13
213 0.13
214 0.11
215 0.1
216 0.07
217 0.07
218 0.08
219 0.08
220 0.06
221 0.05
222 0.05
223 0.05
224 0.05
225 0.05
226 0.05
227 0.06
228 0.06
229 0.1
230 0.16
231 0.17
232 0.2
233 0.23
234 0.23
235 0.24
236 0.31
237 0.3
238 0.27
239 0.3
240 0.38
241 0.43
242 0.52
243 0.54
244 0.51
245 0.5
246 0.55
247 0.62
248 0.62
249 0.61
250 0.59
251 0.6
252 0.59
253 0.57
254 0.52
255 0.42
256 0.35
257 0.27
258 0.2
259 0.15
260 0.11
261 0.11
262 0.08
263 0.07
264 0.03
265 0.03
266 0.03
267 0.03
268 0.03
269 0.06
270 0.06
271 0.08
272 0.09
273 0.1
274 0.12
275 0.13
276 0.19
277 0.19
278 0.21
279 0.22
280 0.25
281 0.26
282 0.28
283 0.29
284 0.26
285 0.25
286 0.25
287 0.25
288 0.27
289 0.27
290 0.28
291 0.27
292 0.26
293 0.27
294 0.27
295 0.26
296 0.22
297 0.21
298 0.18
299 0.18
300 0.16
301 0.14
302 0.12
303 0.1
304 0.1
305 0.09
306 0.07
307 0.07
308 0.07
309 0.07
310 0.07
311 0.07
312 0.06
313 0.09
314 0.12
315 0.15
316 0.18
317 0.19