Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QJ57

Protein Details
Accession G2QJ57    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
5-30AAKLPGRTNKDCRKRWINKVCGNLKRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12, cyto 3.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017930  Myb_dom  
IPR001005  SANT/Myb  
IPR017884  SANT_dom  
KEGG mtm:MYCTH_2037479  -  
Pfam View protein in Pfam  
PF00249  Myb_DNA-binding  
PROSITE View protein in PROSITE  
PS51294  HTH_MYB  
PS50090  MYB_LIKE  
PS51293  SANT  
CDD cd00167  SANT  
Amino Acid Sequences WARVAAKLPGRTNKDCRKRWINKVCGNLKRGAWDEDEDQRLRQAVSKYGQRWTLVASMVGSRSSDQCAKRWQHRLDPRLEHEDWTPEEDDLLLENVQTYGREWKFIQEEDFPTRSSNELKNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.74
3 0.77
4 0.79
5 0.81
6 0.84
7 0.85
8 0.85
9 0.81
10 0.84
11 0.84
12 0.8
13 0.74
14 0.67
15 0.57
16 0.52
17 0.48
18 0.4
19 0.33
20 0.29
21 0.29
22 0.3
23 0.33
24 0.29
25 0.26
26 0.25
27 0.23
28 0.21
29 0.22
30 0.18
31 0.19
32 0.22
33 0.28
34 0.29
35 0.32
36 0.34
37 0.3
38 0.28
39 0.25
40 0.23
41 0.17
42 0.15
43 0.12
44 0.1
45 0.1
46 0.1
47 0.08
48 0.07
49 0.07
50 0.09
51 0.14
52 0.14
53 0.17
54 0.25
55 0.3
56 0.37
57 0.45
58 0.47
59 0.52
60 0.59
61 0.62
62 0.62
63 0.63
64 0.6
65 0.58
66 0.55
67 0.47
68 0.39
69 0.38
70 0.31
71 0.28
72 0.24
73 0.17
74 0.16
75 0.14
76 0.13
77 0.1
78 0.1
79 0.07
80 0.06
81 0.06
82 0.07
83 0.07
84 0.07
85 0.08
86 0.16
87 0.16
88 0.2
89 0.2
90 0.26
91 0.3
92 0.32
93 0.34
94 0.3
95 0.35
96 0.39
97 0.4
98 0.34
99 0.32
100 0.31
101 0.31
102 0.3