Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Q9S0

Protein Details
Accession G2Q9S0    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
44-71HASGGGGMRKRPKKKRQHKTFRTYDLSQBasic
NLS Segment(s)
PositionSequence
48-62GGGMRKRPKKKRQHK
Subcellular Location(s) mito 20.5, mito_nucl 12.333, cyto_nucl 3.333, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR023674  Ribosomal_L1-like  
IPR028364  Ribosomal_L1/biogenesis  
IPR016095  Ribosomal_L1_3-a/b-sand  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
KEGG mtm:MYCTH_2078031  -  
Pfam View protein in Pfam  
PF00687  Ribosomal_L1  
CDD cd00403  Ribosomal_L1  
Amino Acid Sequences MASLNHCLASLARLSLTSPARPTLTSTIPKFLLPTATASPLVRHASGGGGMRKRPKKKRQHKTFRTYDLSQMQQFSLCDAMRYIRAFEVGHPPASVKYELAVKLKATKGGPVIRNRIRLPFPVKTDTRIGVICPEDSPMFTEAQQLGAVAVGEESLFESIREGNIPFNKLICHVDSQEALKKANLGRILGPKGLMPNQKTKTITSDIKTTVKELIGADDYRERDGVVRLAVGQLGFTPQMLSDNIKALMSQLKEDIANIDENHIKQLDEVVLTSTNGPGFSLDGTFFPRDENLKPEDLQSVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.19
3 0.22
4 0.23
5 0.23
6 0.26
7 0.27
8 0.27
9 0.31
10 0.3
11 0.34
12 0.39
13 0.39
14 0.41
15 0.41
16 0.41
17 0.37
18 0.33
19 0.29
20 0.22
21 0.24
22 0.21
23 0.23
24 0.25
25 0.24
26 0.23
27 0.25
28 0.27
29 0.22
30 0.2
31 0.17
32 0.16
33 0.19
34 0.22
35 0.24
36 0.25
37 0.29
38 0.38
39 0.47
40 0.56
41 0.64
42 0.7
43 0.75
44 0.82
45 0.89
46 0.91
47 0.94
48 0.94
49 0.94
50 0.93
51 0.91
52 0.87
53 0.78
54 0.74
55 0.69
56 0.62
57 0.54
58 0.46
59 0.37
60 0.32
61 0.29
62 0.22
63 0.2
64 0.15
65 0.13
66 0.12
67 0.14
68 0.15
69 0.16
70 0.16
71 0.13
72 0.15
73 0.14
74 0.16
75 0.23
76 0.22
77 0.22
78 0.2
79 0.21
80 0.2
81 0.22
82 0.21
83 0.11
84 0.11
85 0.15
86 0.17
87 0.19
88 0.19
89 0.17
90 0.22
91 0.23
92 0.26
93 0.22
94 0.22
95 0.24
96 0.3
97 0.35
98 0.36
99 0.44
100 0.44
101 0.5
102 0.49
103 0.48
104 0.44
105 0.44
106 0.44
107 0.4
108 0.4
109 0.41
110 0.4
111 0.38
112 0.39
113 0.34
114 0.3
115 0.25
116 0.21
117 0.17
118 0.17
119 0.14
120 0.12
121 0.12
122 0.1
123 0.1
124 0.12
125 0.1
126 0.1
127 0.09
128 0.12
129 0.1
130 0.11
131 0.11
132 0.09
133 0.07
134 0.07
135 0.06
136 0.04
137 0.03
138 0.02
139 0.02
140 0.02
141 0.03
142 0.03
143 0.03
144 0.03
145 0.04
146 0.04
147 0.05
148 0.05
149 0.06
150 0.09
151 0.11
152 0.13
153 0.13
154 0.13
155 0.13
156 0.14
157 0.15
158 0.13
159 0.13
160 0.13
161 0.14
162 0.15
163 0.17
164 0.2
165 0.2
166 0.19
167 0.17
168 0.19
169 0.18
170 0.21
171 0.2
172 0.16
173 0.19
174 0.24
175 0.26
176 0.23
177 0.22
178 0.19
179 0.2
180 0.25
181 0.26
182 0.23
183 0.31
184 0.33
185 0.38
186 0.39
187 0.37
188 0.37
189 0.39
190 0.41
191 0.34
192 0.37
193 0.35
194 0.37
195 0.37
196 0.33
197 0.29
198 0.24
199 0.24
200 0.18
201 0.17
202 0.16
203 0.16
204 0.16
205 0.18
206 0.19
207 0.18
208 0.18
209 0.15
210 0.14
211 0.16
212 0.16
213 0.12
214 0.11
215 0.11
216 0.11
217 0.11
218 0.1
219 0.08
220 0.06
221 0.07
222 0.07
223 0.07
224 0.06
225 0.06
226 0.08
227 0.09
228 0.12
229 0.12
230 0.14
231 0.15
232 0.15
233 0.14
234 0.14
235 0.18
236 0.16
237 0.16
238 0.15
239 0.15
240 0.16
241 0.16
242 0.16
243 0.13
244 0.15
245 0.14
246 0.17
247 0.19
248 0.19
249 0.22
250 0.21
251 0.19
252 0.16
253 0.19
254 0.17
255 0.14
256 0.14
257 0.13
258 0.14
259 0.14
260 0.15
261 0.13
262 0.12
263 0.11
264 0.11
265 0.09
266 0.09
267 0.1
268 0.1
269 0.1
270 0.11
271 0.15
272 0.16
273 0.16
274 0.16
275 0.19
276 0.21
277 0.23
278 0.27
279 0.27
280 0.3
281 0.31
282 0.31