Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QML9

Protein Details
Accession G2QML9   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-42PDLEREMPAKRRRVRKGTRSCWECKRRKIRCMLPAPGHydrophilic
NLS Segment(s)
PositionSequence
14-22AKRRRVRKG
Subcellular Location(s) nucl 15, cyto 8, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG mtm:MYCTH_2311136  -  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MAAPAPDLEREMPAKRRRVRKGTRSCWECKRRKIRCMLPAPGDGACIGCHHRGVACVPQDVPEDPFPVKKDKRRLGERLALIEQTLMKDFQVLAGNGIAGLRQTDDQVALKVINILGHHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.62
4 0.69
5 0.76
6 0.81
7 0.83
8 0.87
9 0.87
10 0.9
11 0.86
12 0.84
13 0.83
14 0.84
15 0.81
16 0.81
17 0.82
18 0.8
19 0.81
20 0.84
21 0.82
22 0.82
23 0.81
24 0.77
25 0.7
26 0.63
27 0.56
28 0.46
29 0.37
30 0.27
31 0.19
32 0.13
33 0.1
34 0.1
35 0.09
36 0.09
37 0.09
38 0.09
39 0.09
40 0.11
41 0.14
42 0.14
43 0.14
44 0.14
45 0.16
46 0.16
47 0.16
48 0.17
49 0.13
50 0.13
51 0.13
52 0.15
53 0.15
54 0.22
55 0.27
56 0.32
57 0.41
58 0.47
59 0.55
60 0.61
61 0.65
62 0.64
63 0.67
64 0.62
65 0.56
66 0.5
67 0.41
68 0.33
69 0.28
70 0.22
71 0.15
72 0.14
73 0.09
74 0.08
75 0.08
76 0.08
77 0.1
78 0.14
79 0.13
80 0.13
81 0.12
82 0.12
83 0.12
84 0.12
85 0.09
86 0.05
87 0.05
88 0.06
89 0.06
90 0.07
91 0.08
92 0.1
93 0.12
94 0.13
95 0.14
96 0.13
97 0.12
98 0.13
99 0.13
100 0.13