Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Q7B1

Protein Details
Accession G2Q7B1    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
16-51LSQRRGETCKKDKTQRRQGKRNEKGQRQKRHHLPPFBasic
NLS Segment(s)
PositionSequence
26-46KDKTQRRQGKRNEKGQRQKRH
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 3.5, mito 3
Family & Domain DBs
KEGG mtm:MYCTH_101019  -  
Amino Acid Sequences MDLYVYNARQWQPTLLSQRRGETCKKDKTQRRQGKRNEKGQRQKRHHLPPFAPYNPASQPTLVDRTSRATPYHSATFHLPVPLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.47
4 0.47
5 0.51
6 0.53
7 0.53
8 0.53
9 0.52
10 0.55
11 0.58
12 0.63
13 0.67
14 0.72
15 0.79
16 0.84
17 0.84
18 0.86
19 0.86
20 0.88
21 0.9
22 0.88
23 0.88
24 0.86
25 0.86
26 0.86
27 0.86
28 0.86
29 0.82
30 0.83
31 0.82
32 0.83
33 0.8
34 0.77
35 0.69
36 0.65
37 0.66
38 0.57
39 0.51
40 0.41
41 0.38
42 0.32
43 0.33
44 0.27
45 0.19
46 0.19
47 0.2
48 0.24
49 0.21
50 0.2
51 0.19
52 0.23
53 0.26
54 0.27
55 0.24
56 0.24
57 0.27
58 0.31
59 0.37
60 0.33
61 0.32
62 0.33
63 0.35
64 0.33