Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2Q6A6

Protein Details
Accession G2Q6A6    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
111-132FAKRRGIKPKTREQRRNLRYNEBasic
169-202GTSVRGDKRREIRERVKRNERRMRRNQRIAEGRKBasic
NLS Segment(s)
PositionSequence
97-126KPVPAPKPETKWAAFAKRRGIKPKTREQRR
167-202KEGTSVRGDKRREIRERVKRNERRMRRNQRIAEGRK
Subcellular Location(s) nucl 12.5, cyto_nucl 10.333, cyto_mito 7.333, cyto 7, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
KEGG mtm:MYCTH_2295771  -  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MSTETAQKPAKLPVTVDKPTPYNFDLGLLLANDPNPVAIPASCAGDRAALEAHLASVARDGAQVLINQLLTTCAVSSTPAGVLLSLPAPQTALPREKPVPAPKPETKWAAFAKRRGIKPKTREQRRNLRYNEETGEWERKWGYKGANKAGQDDPIIELNPAKEAQRKEGTSVRGDKRREIRERVKRNERRMRRNQRIAEGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.45
3 0.46
4 0.43
5 0.41
6 0.41
7 0.44
8 0.35
9 0.29
10 0.27
11 0.25
12 0.22
13 0.18
14 0.17
15 0.12
16 0.12
17 0.1
18 0.1
19 0.09
20 0.08
21 0.08
22 0.07
23 0.07
24 0.07
25 0.06
26 0.09
27 0.09
28 0.13
29 0.12
30 0.13
31 0.13
32 0.13
33 0.13
34 0.12
35 0.11
36 0.08
37 0.09
38 0.08
39 0.08
40 0.07
41 0.07
42 0.05
43 0.06
44 0.06
45 0.05
46 0.06
47 0.06
48 0.06
49 0.07
50 0.07
51 0.07
52 0.08
53 0.08
54 0.08
55 0.07
56 0.07
57 0.06
58 0.06
59 0.05
60 0.04
61 0.04
62 0.05
63 0.06
64 0.06
65 0.05
66 0.06
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.06
77 0.08
78 0.1
79 0.14
80 0.14
81 0.18
82 0.2
83 0.21
84 0.26
85 0.32
86 0.36
87 0.36
88 0.42
89 0.42
90 0.45
91 0.47
92 0.47
93 0.4
94 0.38
95 0.38
96 0.41
97 0.41
98 0.4
99 0.45
100 0.48
101 0.51
102 0.55
103 0.57
104 0.57
105 0.6
106 0.67
107 0.68
108 0.73
109 0.77
110 0.77
111 0.81
112 0.81
113 0.83
114 0.76
115 0.74
116 0.66
117 0.6
118 0.55
119 0.45
120 0.41
121 0.35
122 0.37
123 0.29
124 0.28
125 0.25
126 0.24
127 0.24
128 0.24
129 0.27
130 0.26
131 0.33
132 0.39
133 0.45
134 0.44
135 0.46
136 0.44
137 0.39
138 0.35
139 0.29
140 0.23
141 0.18
142 0.18
143 0.14
144 0.13
145 0.12
146 0.13
147 0.13
148 0.13
149 0.17
150 0.19
151 0.26
152 0.33
153 0.33
154 0.36
155 0.41
156 0.43
157 0.45
158 0.52
159 0.53
160 0.53
161 0.55
162 0.58
163 0.62
164 0.68
165 0.69
166 0.7
167 0.72
168 0.75
169 0.83
170 0.86
171 0.88
172 0.87
173 0.9
174 0.91
175 0.91
176 0.91
177 0.92
178 0.93
179 0.93
180 0.94
181 0.9
182 0.9