Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QPF4

Protein Details
Accession G2QPF4    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
528-552GGPRGGFRRGRGRGRRDYRGGRGGSBasic
NLS Segment(s)
PositionSequence
417-418GR
530-553PRGGFRRGRGRGRRDYRGGRGGSG
Subcellular Location(s) mito 11, extr 8, nucl 4.5, cyto_nucl 4.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025762  DFDF  
IPR019050  FDF_dom  
IPR025761  FFD_box  
IPR025609  Lsm14-like_N  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
KEGG mtm:MYCTH_2316492  -  
Pfam View protein in Pfam  
PF09532  FDF  
PF12701  LSM14  
PROSITE View protein in PROSITE  
PS51512  DFDF  
PS51513  FFD  
PS52002  SM  
CDD cd01736  LSm14_N  
Amino Acid Sequences MSEFIGARISLISRSDIRYSGTLHSINSDDSTVSLENVRSFGTEHRKTNPDEFVPPSDQLYEYIVFRGTDVKDLRIEEGPAPVKEEKPPAVPNDPAILGARPRPGNAAPGLSGPVGPQGPQGPQGPIGHAGPQNQQGPPPGAPGFGYFPPHMSGWGRAGAPGPGPGPFGGMPYPPPGWFPPGQEFPPMGHGPWGPYPFQPGPGGHPGAPGAPGAPGQGRQSANQTPSNQGPTQKPAPIGPAADRTPTTPSQPASASSEPKTADLAHMQPAAAAPPPPPVESKPTVEEVNATAASISNKSPTAAGQAASVPTGPKGNRPTQIMPAVPLPAALTAKVAQNQSGPKPLADQTNTAAAAAALRDATQAAKDAVARAMAQVDSSATTLQQAETNGVDNLTKRVNEMRINAARSGQSNRGGRGRGPRPAKVEVPDTDFDFASANAKFNKQDIVKEAVASSSLGEAGLANGADPEASDAIPPAEPAYNKNKSFFDNISSDLKDRENAAQRPGGAHWRGEETRKNIETFGLGSVDGGPRGGFRRGRGRGRRDYRGGRGGSGGYRSRGPQTAPSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.25
4 0.27
5 0.28
6 0.29
7 0.29
8 0.32
9 0.3
10 0.27
11 0.29
12 0.27
13 0.26
14 0.24
15 0.21
16 0.15
17 0.14
18 0.17
19 0.14
20 0.14
21 0.15
22 0.15
23 0.16
24 0.16
25 0.16
26 0.14
27 0.15
28 0.22
29 0.29
30 0.35
31 0.38
32 0.44
33 0.49
34 0.53
35 0.59
36 0.58
37 0.52
38 0.5
39 0.5
40 0.49
41 0.48
42 0.44
43 0.39
44 0.33
45 0.3
46 0.26
47 0.25
48 0.2
49 0.17
50 0.17
51 0.17
52 0.15
53 0.15
54 0.19
55 0.17
56 0.22
57 0.23
58 0.25
59 0.27
60 0.28
61 0.31
62 0.27
63 0.29
64 0.22
65 0.28
66 0.3
67 0.26
68 0.3
69 0.29
70 0.29
71 0.31
72 0.36
73 0.31
74 0.33
75 0.37
76 0.37
77 0.4
78 0.39
79 0.37
80 0.35
81 0.32
82 0.28
83 0.25
84 0.21
85 0.19
86 0.21
87 0.25
88 0.22
89 0.23
90 0.26
91 0.25
92 0.28
93 0.27
94 0.26
95 0.2
96 0.21
97 0.22
98 0.18
99 0.17
100 0.13
101 0.14
102 0.12
103 0.12
104 0.12
105 0.13
106 0.14
107 0.18
108 0.19
109 0.17
110 0.21
111 0.21
112 0.21
113 0.21
114 0.21
115 0.22
116 0.22
117 0.24
118 0.24
119 0.29
120 0.3
121 0.28
122 0.29
123 0.27
124 0.29
125 0.26
126 0.27
127 0.21
128 0.19
129 0.18
130 0.19
131 0.19
132 0.17
133 0.21
134 0.17
135 0.17
136 0.19
137 0.19
138 0.19
139 0.17
140 0.18
141 0.16
142 0.19
143 0.17
144 0.16
145 0.17
146 0.15
147 0.14
148 0.14
149 0.12
150 0.1
151 0.11
152 0.1
153 0.11
154 0.1
155 0.11
156 0.11
157 0.11
158 0.11
159 0.14
160 0.15
161 0.13
162 0.15
163 0.15
164 0.19
165 0.2
166 0.23
167 0.25
168 0.28
169 0.29
170 0.29
171 0.29
172 0.24
173 0.29
174 0.26
175 0.2
176 0.18
177 0.17
178 0.18
179 0.22
180 0.23
181 0.18
182 0.17
183 0.24
184 0.22
185 0.24
186 0.24
187 0.2
188 0.23
189 0.27
190 0.28
191 0.22
192 0.22
193 0.2
194 0.18
195 0.18
196 0.13
197 0.08
198 0.06
199 0.06
200 0.07
201 0.07
202 0.08
203 0.09
204 0.15
205 0.15
206 0.16
207 0.21
208 0.24
209 0.27
210 0.3
211 0.3
212 0.28
213 0.3
214 0.34
215 0.3
216 0.3
217 0.29
218 0.3
219 0.32
220 0.31
221 0.29
222 0.25
223 0.27
224 0.24
225 0.23
226 0.19
227 0.2
228 0.19
229 0.19
230 0.19
231 0.17
232 0.2
233 0.2
234 0.21
235 0.19
236 0.18
237 0.19
238 0.2
239 0.2
240 0.22
241 0.23
242 0.24
243 0.22
244 0.25
245 0.23
246 0.23
247 0.22
248 0.16
249 0.15
250 0.14
251 0.14
252 0.13
253 0.13
254 0.12
255 0.11
256 0.11
257 0.11
258 0.09
259 0.08
260 0.06
261 0.09
262 0.1
263 0.11
264 0.13
265 0.13
266 0.18
267 0.21
268 0.22
269 0.21
270 0.22
271 0.21
272 0.2
273 0.19
274 0.14
275 0.14
276 0.12
277 0.09
278 0.07
279 0.08
280 0.08
281 0.09
282 0.08
283 0.07
284 0.08
285 0.08
286 0.08
287 0.08
288 0.11
289 0.11
290 0.11
291 0.1
292 0.1
293 0.1
294 0.1
295 0.1
296 0.07
297 0.06
298 0.1
299 0.09
300 0.14
301 0.19
302 0.24
303 0.27
304 0.32
305 0.34
306 0.35
307 0.39
308 0.33
309 0.3
310 0.26
311 0.23
312 0.18
313 0.16
314 0.11
315 0.09
316 0.09
317 0.07
318 0.07
319 0.07
320 0.09
321 0.12
322 0.13
323 0.12
324 0.15
325 0.18
326 0.19
327 0.23
328 0.22
329 0.19
330 0.22
331 0.23
332 0.26
333 0.24
334 0.24
335 0.2
336 0.23
337 0.23
338 0.2
339 0.17
340 0.12
341 0.1
342 0.09
343 0.08
344 0.04
345 0.04
346 0.04
347 0.04
348 0.05
349 0.05
350 0.06
351 0.06
352 0.07
353 0.07
354 0.08
355 0.09
356 0.09
357 0.09
358 0.08
359 0.09
360 0.08
361 0.07
362 0.06
363 0.06
364 0.06
365 0.07
366 0.07
367 0.05
368 0.07
369 0.07
370 0.07
371 0.09
372 0.09
373 0.09
374 0.1
375 0.11
376 0.1
377 0.1
378 0.11
379 0.1
380 0.12
381 0.12
382 0.12
383 0.12
384 0.16
385 0.21
386 0.24
387 0.26
388 0.33
389 0.35
390 0.38
391 0.37
392 0.35
393 0.32
394 0.31
395 0.32
396 0.28
397 0.3
398 0.31
399 0.33
400 0.36
401 0.36
402 0.37
403 0.42
404 0.43
405 0.44
406 0.47
407 0.49
408 0.5
409 0.53
410 0.53
411 0.47
412 0.47
413 0.41
414 0.41
415 0.37
416 0.33
417 0.3
418 0.26
419 0.23
420 0.18
421 0.16
422 0.13
423 0.13
424 0.13
425 0.14
426 0.16
427 0.17
428 0.17
429 0.24
430 0.22
431 0.25
432 0.27
433 0.32
434 0.3
435 0.3
436 0.29
437 0.22
438 0.21
439 0.18
440 0.14
441 0.08
442 0.07
443 0.06
444 0.06
445 0.05
446 0.05
447 0.06
448 0.05
449 0.05
450 0.05
451 0.05
452 0.04
453 0.04
454 0.06
455 0.06
456 0.06
457 0.06
458 0.07
459 0.08
460 0.09
461 0.09
462 0.09
463 0.11
464 0.12
465 0.17
466 0.25
467 0.33
468 0.34
469 0.38
470 0.39
471 0.39
472 0.44
473 0.42
474 0.38
475 0.33
476 0.35
477 0.36
478 0.36
479 0.34
480 0.3
481 0.3
482 0.26
483 0.26
484 0.3
485 0.34
486 0.35
487 0.38
488 0.39
489 0.38
490 0.39
491 0.39
492 0.4
493 0.32
494 0.31
495 0.29
496 0.33
497 0.35
498 0.39
499 0.44
500 0.41
501 0.48
502 0.5
503 0.49
504 0.42
505 0.4
506 0.36
507 0.3
508 0.26
509 0.18
510 0.14
511 0.13
512 0.15
513 0.15
514 0.13
515 0.12
516 0.1
517 0.11
518 0.15
519 0.22
520 0.22
521 0.27
522 0.38
523 0.46
524 0.57
525 0.65
526 0.71
527 0.75
528 0.81
529 0.85
530 0.84
531 0.84
532 0.83
533 0.82
534 0.74
535 0.65
536 0.59
537 0.52
538 0.46
539 0.44
540 0.39
541 0.33
542 0.34
543 0.35
544 0.37
545 0.37
546 0.37