FuNGI

G2QME7

Protein Details

Accession

G2QME7

Localization Confidence

Medium

Confidence Score

14.3

NoLS Segment(s)

Position	Sequence	Protein Nature
87-113	TTVTPEPEKKPVKKRKSWGQVLPEPKT	Hydrophilic

NLS Segment(s)

Position	Sequence
95-150	KKPVKKRKSWGQVLPEPKTNLPPRKRAKTEDEKEQRRVERVLRNRRAAQSSRERKR

Subcellular Location(s)

nucl 23.5, cyto_nucl 14

Family & Domain DBs

InterPro	View protein in InterPro IPR004827 bZIP IPR046347 bZIP_sf IPR044280 Hac1/HY5
Gene Ontology	GO:0005634 C:nucleus GO:0000981 F:DNA-binding transcription factor activity, RNA polymerase II-specific GO:0045944 P:positive regulation of transcription by RNA polymerase II GO:0006986 P:response to unfolded protein
KEGG	mtm:MYCTH_2310995 -
Pfam	View protein in Pfam PF07716 bZIP_2
PROSITE	View protein in PROSITE PS50217 BZIP
CDD	cd14710 bZIP_HAC1-like

Amino Acid Sequences

MSEMHSWASAASPSIKFEGSPAESILSTPDEMYPSLFGTSPAPTTTVNPVDMRSSQPAPQLPKPDLTLLAGLTALTHTTLAAPPAPTTVTPEPEKKPVKKRKSWGQVLPEPKTNLPPRKRAKTEDEKEQRRVERVLRNRRAAQSSRERKRLEVEGLERRNKELEAALLQAQQINLTLLEELQRMRGGSGARTSPAFEALRPTPVTFSQQLFGSQGDHNPAMGSTSTLQQILQSIPSATNKTVDPSSLSPALPPIPEAAEEENKQPAAPAAPVADAPTTAQASTSPDATQHPAEMLCPDLQCRSAEAPASPWQRASQQQLHPAQTLLLQLQFLLASTSAMVSICQRPLTQIAISLKADFSLPPTQAILNTIIWLVTTPRRFHSRPTSTSTNSSPTASSMARPAASSSSSSNSLAALSPTRHSSTLRLRTLRKILTCSPTLARPLMDATMAVLRLVSTEGRSGDRVSGADESAAAAVSGVSPQQLPRRGLSGWLNGAALPSKEVLLTLLWVLRVEERRLQIREQAKALSKPGTSGVTQTTTPANKTTFVLKVLRKREEEEQDRPASLKRRRFQ

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.21
2	0.21
3	0.19
4	0.2
5	0.26
6	0.23
7	0.24
8	0.23
9	0.22
10	0.22
11	0.22
12	0.23
13	0.17
14	0.15
15	0.14
16	0.14
17	0.14
18	0.15
19	0.16
20	0.14
21	0.13
22	0.14
23	0.13
24	0.13
25	0.13
26	0.15
27	0.16
28	0.15
29	0.16
30	0.15
31	0.18
32	0.24
33	0.25
34	0.26
35	0.26
36	0.26
37	0.28
38	0.29
39	0.31
40	0.29
41	0.29
42	0.29
43	0.34
44	0.38
45	0.42
46	0.46
47	0.48
48	0.45
49	0.46
50	0.45
51	0.42
52	0.38
53	0.32
54	0.28
55	0.21
56	0.19
57	0.15
58	0.12
59	0.1
60	0.09
61	0.07
62	0.06
63	0.06
64	0.05
65	0.07
66	0.08
67	0.09
68	0.11
69	0.12
70	0.12
71	0.13
72	0.15
73	0.13
74	0.2
75	0.22
76	0.24
77	0.28
78	0.34
79	0.37
80	0.45
81	0.54
82	0.55
83	0.63
84	0.69
85	0.75
86	0.78
87	0.84
88	0.86
89	0.88
90	0.88
91	0.86
92	0.85
93	0.82
94	0.82
95	0.76
96	0.72
97	0.64
98	0.56
99	0.56
100	0.55
101	0.57
102	0.55
103	0.61
104	0.65
105	0.72
106	0.76
107	0.75
108	0.76
109	0.77
110	0.76
111	0.77
112	0.78
113	0.75
114	0.76
115	0.76
116	0.7
117	0.63
118	0.61
119	0.58
120	0.57
121	0.6
122	0.65
123	0.66
124	0.69
125	0.71
126	0.72
127	0.72
128	0.66
129	0.65
130	0.65
131	0.67
132	0.68
133	0.71
134	0.66
135	0.61
136	0.62
137	0.59
138	0.53
139	0.49
140	0.47
141	0.49
142	0.55
143	0.59
144	0.54
145	0.49
146	0.46
147	0.39
148	0.33
149	0.24
150	0.19
151	0.15
152	0.16
153	0.16
154	0.16
155	0.16
156	0.15
157	0.14
158	0.12
159	0.1
160	0.09
161	0.07
162	0.06
163	0.06
164	0.05
165	0.07
166	0.08
167	0.08
168	0.08
169	0.09
170	0.09
171	0.09
172	0.11
173	0.11
174	0.12
175	0.15
176	0.15
177	0.15
178	0.15
179	0.16
180	0.14
181	0.18
182	0.17
183	0.14
184	0.18
185	0.18
186	0.22
187	0.21
188	0.21
189	0.18
190	0.19
191	0.23
192	0.2
193	0.21
194	0.18
195	0.18
196	0.18
197	0.18
198	0.17
199	0.15
200	0.13
201	0.13
202	0.15
203	0.14
204	0.13
205	0.12
206	0.12
207	0.1
208	0.09
209	0.09
210	0.07
211	0.08
212	0.09
213	0.09
214	0.09
215	0.09
216	0.1
217	0.09
218	0.09
219	0.08
220	0.08
221	0.09
222	0.11
223	0.13
224	0.11
225	0.13
226	0.12
227	0.14
228	0.14
229	0.13
230	0.14
231	0.13
232	0.16
233	0.17
234	0.17
235	0.14
236	0.15
237	0.16
238	0.13
239	0.12
240	0.09
241	0.07
242	0.08
243	0.1
244	0.11
245	0.13
246	0.14
247	0.15
248	0.16
249	0.15
250	0.14
251	0.13
252	0.11
253	0.09
254	0.08
255	0.07
256	0.06
257	0.07
258	0.07
259	0.08
260	0.07
261	0.06
262	0.06
263	0.07
264	0.06
265	0.06
266	0.06
267	0.06
268	0.09
269	0.09
270	0.1
271	0.08
272	0.09
273	0.1
274	0.13
275	0.12
276	0.09
277	0.09
278	0.09
279	0.09
280	0.08
281	0.09
282	0.08
283	0.07
284	0.08
285	0.08
286	0.09
287	0.09
288	0.11
289	0.11
290	0.11
291	0.11
292	0.11
293	0.13
294	0.19
295	0.22
296	0.2
297	0.2
298	0.2
299	0.22
300	0.26
301	0.29
302	0.3
303	0.31
304	0.39
305	0.42
306	0.43
307	0.41
308	0.37
309	0.31
310	0.24
311	0.21
312	0.14
313	0.1
314	0.07
315	0.07
316	0.07
317	0.06
318	0.05
319	0.05
320	0.04
321	0.04
322	0.04
323	0.04
324	0.04
325	0.04
326	0.04
327	0.06
328	0.08
329	0.09
330	0.1
331	0.1
332	0.11
333	0.13
334	0.15
335	0.13
336	0.16
337	0.17
338	0.19
339	0.2
340	0.19
341	0.17
342	0.15
343	0.15
344	0.1
345	0.13
346	0.13
347	0.13
348	0.13
349	0.14
350	0.14
351	0.14
352	0.16
353	0.14
354	0.1
355	0.11
356	0.1
357	0.09
358	0.08
359	0.08
360	0.09
361	0.12
362	0.15
363	0.17
364	0.2
365	0.27
366	0.28
367	0.35
368	0.43
369	0.47
370	0.47
371	0.53
372	0.57
373	0.53
374	0.57
375	0.53
376	0.46
377	0.39
378	0.36
379	0.28
380	0.22
381	0.23
382	0.19
383	0.17
384	0.16
385	0.16
386	0.16
387	0.16
388	0.16
389	0.14
390	0.14
391	0.15
392	0.14
393	0.15
394	0.17
395	0.17
396	0.16
397	0.15
398	0.14
399	0.13
400	0.13
401	0.12
402	0.12
403	0.13
404	0.16
405	0.17
406	0.18
407	0.19
408	0.24
409	0.32
410	0.4
411	0.46
412	0.49
413	0.51
414	0.56
415	0.63
416	0.62
417	0.55
418	0.51
419	0.5
420	0.49
421	0.47
422	0.44
423	0.38
424	0.36
425	0.36
426	0.31
427	0.25
428	0.21
429	0.21
430	0.18
431	0.16
432	0.12
433	0.1
434	0.12
435	0.11
436	0.1
437	0.08
438	0.07
439	0.08
440	0.09
441	0.08
442	0.07
443	0.09
444	0.11
445	0.13
446	0.15
447	0.15
448	0.16
449	0.17
450	0.16
451	0.16
452	0.16
453	0.14
454	0.13
455	0.12
456	0.11
457	0.09
458	0.09
459	0.06
460	0.05
461	0.04
462	0.04
463	0.05
464	0.04
465	0.05
466	0.06
467	0.09
468	0.17
469	0.23
470	0.26
471	0.27
472	0.3
473	0.3
474	0.35
475	0.37
476	0.36
477	0.32
478	0.31
479	0.29
480	0.26
481	0.27
482	0.23
483	0.18
484	0.13
485	0.11
486	0.1
487	0.1
488	0.1
489	0.1
490	0.08
491	0.09
492	0.09
493	0.1
494	0.1
495	0.1
496	0.11
497	0.16
498	0.2
499	0.23
500	0.27
501	0.31
502	0.39
503	0.41
504	0.43
505	0.45
506	0.47
507	0.49
508	0.46
509	0.48
510	0.46
511	0.47
512	0.48
513	0.46
514	0.39
515	0.35
516	0.36
517	0.32
518	0.27
519	0.26
520	0.26
521	0.24
522	0.24
523	0.24
524	0.28
525	0.28
526	0.29
527	0.31
528	0.28
529	0.27
530	0.29
531	0.32
532	0.29
533	0.3
534	0.36
535	0.39
536	0.47
537	0.54
538	0.6
539	0.58
540	0.6
541	0.65
542	0.68
543	0.68
544	0.66
545	0.65
546	0.61
547	0.59
548	0.56
549	0.53
550	0.53
551	0.54

G2QME7

3D AlphaFold-predicted Structure Viewer