Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QD11

Protein Details
Accession G2QD11   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
263-311GLCIWCRRPNPDRRKKGCPTCLPRRAGLTAEWRRKRKAAERRRRGELGDHydrophilic
NLS Segment(s)
PositionSequence
292-307AEWRRKRKAAERRRRG
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 5, cyto 2, plas 2, extr 2
Family & Domain DBs
KEGG mtm:MYCTH_93590  -  
Amino Acid Sequences MSAQSNRCARCGNNTADRLLCVECQRSDMVAGSGQADNYSAASTALGYLAQPGGYYPSNIPANPYAHRLRLYPQNHGDNDSQLTPSESWLAPPPYTPSAPNPNQQLAPQQPVQGFLGTPQVGFQLPAPSQGPWVPTQGLPYAPVAAAAALAAPNNPPFLGYQLLPLRFGAAAAPFGPYSPYQTLLAQRYHLGYSNNSQTSAGADDRHNDIKNQGQQNLNLYKERADNQGQSDNGNNDNDNDGEPAPRPLGTRGRRNAALVARGLCIWCRRPNPDRRKKGCPTCLPRRAGLTAEWRRKRKAAERRRRGELGDLEGEDEGEDEGGREDGIEDEERGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.52
3 0.49
4 0.48
5 0.41
6 0.35
7 0.31
8 0.26
9 0.28
10 0.25
11 0.26
12 0.27
13 0.25
14 0.24
15 0.22
16 0.19
17 0.16
18 0.16
19 0.16
20 0.15
21 0.15
22 0.13
23 0.12
24 0.11
25 0.1
26 0.1
27 0.07
28 0.07
29 0.07
30 0.07
31 0.06
32 0.06
33 0.06
34 0.05
35 0.06
36 0.07
37 0.07
38 0.06
39 0.06
40 0.1
41 0.11
42 0.12
43 0.12
44 0.18
45 0.21
46 0.21
47 0.24
48 0.25
49 0.28
50 0.28
51 0.33
52 0.3
53 0.31
54 0.33
55 0.31
56 0.3
57 0.37
58 0.38
59 0.41
60 0.45
61 0.49
62 0.49
63 0.51
64 0.48
65 0.41
66 0.41
67 0.33
68 0.26
69 0.18
70 0.2
71 0.16
72 0.15
73 0.16
74 0.13
75 0.14
76 0.19
77 0.21
78 0.18
79 0.19
80 0.23
81 0.23
82 0.24
83 0.24
84 0.24
85 0.32
86 0.35
87 0.39
88 0.39
89 0.38
90 0.38
91 0.37
92 0.39
93 0.32
94 0.34
95 0.3
96 0.29
97 0.26
98 0.27
99 0.27
100 0.21
101 0.17
102 0.13
103 0.17
104 0.14
105 0.13
106 0.11
107 0.11
108 0.11
109 0.11
110 0.11
111 0.11
112 0.11
113 0.13
114 0.14
115 0.13
116 0.14
117 0.15
118 0.16
119 0.13
120 0.15
121 0.14
122 0.13
123 0.15
124 0.15
125 0.14
126 0.13
127 0.12
128 0.11
129 0.09
130 0.09
131 0.07
132 0.06
133 0.05
134 0.04
135 0.04
136 0.03
137 0.03
138 0.03
139 0.04
140 0.04
141 0.04
142 0.04
143 0.05
144 0.05
145 0.07
146 0.08
147 0.08
148 0.12
149 0.15
150 0.16
151 0.16
152 0.16
153 0.15
154 0.13
155 0.13
156 0.09
157 0.05
158 0.06
159 0.05
160 0.06
161 0.05
162 0.06
163 0.07
164 0.06
165 0.1
166 0.1
167 0.12
168 0.12
169 0.14
170 0.18
171 0.2
172 0.21
173 0.18
174 0.18
175 0.18
176 0.17
177 0.18
178 0.15
179 0.13
180 0.16
181 0.22
182 0.22
183 0.21
184 0.2
185 0.18
186 0.18
187 0.19
188 0.16
189 0.11
190 0.11
191 0.13
192 0.17
193 0.21
194 0.2
195 0.18
196 0.19
197 0.24
198 0.31
199 0.33
200 0.33
201 0.32
202 0.32
203 0.39
204 0.41
205 0.37
206 0.31
207 0.27
208 0.25
209 0.26
210 0.27
211 0.25
212 0.24
213 0.25
214 0.27
215 0.32
216 0.3
217 0.29
218 0.29
219 0.26
220 0.25
221 0.23
222 0.2
223 0.16
224 0.17
225 0.16
226 0.14
227 0.14
228 0.12
229 0.12
230 0.12
231 0.13
232 0.12
233 0.13
234 0.13
235 0.16
236 0.26
237 0.31
238 0.4
239 0.44
240 0.49
241 0.5
242 0.5
243 0.51
244 0.45
245 0.42
246 0.35
247 0.31
248 0.26
249 0.25
250 0.23
251 0.2
252 0.21
253 0.23
254 0.28
255 0.31
256 0.39
257 0.48
258 0.58
259 0.67
260 0.74
261 0.8
262 0.8
263 0.84
264 0.87
265 0.88
266 0.88
267 0.87
268 0.86
269 0.85
270 0.87
271 0.81
272 0.74
273 0.68
274 0.61
275 0.52
276 0.47
277 0.47
278 0.48
279 0.55
280 0.61
281 0.61
282 0.64
283 0.67
284 0.71
285 0.7
286 0.71
287 0.72
288 0.75
289 0.8
290 0.83
291 0.86
292 0.81
293 0.73
294 0.71
295 0.65
296 0.6
297 0.54
298 0.46
299 0.39
300 0.35
301 0.32
302 0.23
303 0.18
304 0.11
305 0.07
306 0.06
307 0.05
308 0.06
309 0.06
310 0.06
311 0.06
312 0.06
313 0.07
314 0.11
315 0.12