Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Q065

Protein Details
Accession G2Q065    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
40-63AIIKDIRRFKKRRARKSAVATPGTHydrophilic
NLS Segment(s)
PositionSequence
44-55DIRRFKKRRARK
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
KEGG mtm:MYCTH_2299868  -  
Amino Acid Sequences MSIDDSDDDRFDFTDSEDRQEEDVESPSLSRGKKESPYMAIIKDIRRFKKRRARKSAVATPGTEDNNHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.23
4 0.23
5 0.24
6 0.23
7 0.24
8 0.23
9 0.16
10 0.17
11 0.13
12 0.12
13 0.11
14 0.12
15 0.15
16 0.14
17 0.13
18 0.14
19 0.17
20 0.21
21 0.24
22 0.25
23 0.24
24 0.28
25 0.28
26 0.26
27 0.26
28 0.25
29 0.27
30 0.31
31 0.36
32 0.39
33 0.47
34 0.5
35 0.57
36 0.65
37 0.72
38 0.76
39 0.8
40 0.81
41 0.82
42 0.88
43 0.87
44 0.85
45 0.77
46 0.67
47 0.6
48 0.57
49 0.49