FuNGI

G2Q6A5

Protein Details

Accession

G2Q6A5

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
70-98	ASKRAGKKLQLGKFKKKDRIAEKGRPPLP	Basic

NLS Segment(s)

Position	Sequence
69-107	PASKRAGKKLQLGKFKKKDRIAEKGRPPLPGERKAYRKR

Subcellular Location(s)

mito 24.5, cyto_mito 13.5

Family & Domain DBs

InterPro	View protein in InterPro IPR019368 Ribosomal_S23/S29_mit IPR017082 Ribosomal_S23_mit_fun
Gene Ontology	GO:0005763 C:mitochondrial small ribosomal subunit GO:0032543 P:mitochondrial translation
KEGG	mtm:MYCTH_2295769 -
Pfam	View protein in Pfam PF10236 DAP3

Amino Acid Sequences

MSAPNCLRCLVRPSARVPVSVPRARAPIVPIASIAPITAPIAAPIAASRPAPFSTTSANAKPKQAQNEPASKRAGKKLQLGKFKKKDRIAEKGRPPLPGERKAYRKRITLSNDNAIPVPWLTDLGPADLATSENIAKVMALPEELQDQLRASEAFKPTQCWGMFRKPAVLVRKETVDLTNRMQEAAANRQILRLVVTGDKVAGKSLMLLQAMSHAFLNDWIVLHFPEAQELTTACTEYAPIPGTDPVQYMQPVYVLKLIQAFRRANEKVLSKTYTTQAHPQLPQNISANTPLLTLANLAKEPDNAWAVFQALWNELTARGASRPPILISLDGLAHAMKVSDYRSPSFELIHSHDLALLRLFANALGGGAHFPGGGAVLAATSRSNAPRAPSMELALAQREAEQRLRADVPGVRVPQKDPYFRGYDERVEAVLRSVQVLRLGGLDKLEARALMEYWAASGMLRATVNERTVTEKWTLAGHGVVGEMERAALLTMRI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.55
2	0.55
3	0.52
4	0.48
5	0.49
6	0.5
7	0.5
8	0.48
9	0.42
10	0.45
11	0.45
12	0.44
13	0.38
14	0.37
15	0.34
16	0.32
17	0.28
18	0.26
19	0.25
20	0.22
21	0.18
22	0.1
23	0.09
24	0.09
25	0.09
26	0.07
27	0.07
28	0.08
29	0.08
30	0.08
31	0.08
32	0.1
33	0.11
34	0.12
35	0.12
36	0.14
37	0.15
38	0.17
39	0.18
40	0.18
41	0.21
42	0.26
43	0.31
44	0.35
45	0.42
46	0.44
47	0.48
48	0.53
49	0.55
50	0.58
51	0.59
52	0.61
53	0.6
54	0.67
55	0.66
56	0.63
57	0.63
58	0.59
59	0.58
60	0.58
61	0.59
62	0.54
63	0.59
64	0.64
65	0.66
66	0.72
67	0.75
68	0.77
69	0.79
70	0.82
71	0.82
72	0.8
73	0.81
74	0.79
75	0.81
76	0.79
77	0.8
78	0.8
79	0.81
80	0.76
81	0.7
82	0.65
83	0.64
84	0.63
85	0.61
86	0.59
87	0.57
88	0.64
89	0.7
90	0.77
91	0.73
92	0.71
93	0.67
94	0.69
95	0.69
96	0.69
97	0.66
98	0.64
99	0.59
100	0.53
101	0.48
102	0.39
103	0.32
104	0.23
105	0.17
106	0.1
107	0.09
108	0.08
109	0.12
110	0.12
111	0.12
112	0.12
113	0.11
114	0.11
115	0.1
116	0.1
117	0.07
118	0.08
119	0.07
120	0.07
121	0.07
122	0.06
123	0.06
124	0.07
125	0.08
126	0.06
127	0.07
128	0.07
129	0.08
130	0.09
131	0.1
132	0.1
133	0.09
134	0.09
135	0.09
136	0.1
137	0.09
138	0.09
139	0.14
140	0.16
141	0.2
142	0.2
143	0.23
144	0.23
145	0.29
146	0.29
147	0.26
148	0.29
149	0.34
150	0.38
151	0.36
152	0.39
153	0.35
154	0.4
155	0.44
156	0.43
157	0.37
158	0.34
159	0.36
160	0.33
161	0.31
162	0.28
163	0.26
164	0.24
165	0.23
166	0.26
167	0.24
168	0.23
169	0.22
170	0.2
171	0.19
172	0.22
173	0.24
174	0.21
175	0.21
176	0.21
177	0.22
178	0.2
179	0.19
180	0.13
181	0.1
182	0.1
183	0.1
184	0.1
185	0.1
186	0.11
187	0.09
188	0.09
189	0.07
190	0.06
191	0.06
192	0.07
193	0.09
194	0.08
195	0.08
196	0.08
197	0.11
198	0.12
199	0.11
200	0.1
201	0.08
202	0.07
203	0.08
204	0.09
205	0.05
206	0.05
207	0.05
208	0.06
209	0.06
210	0.06
211	0.07
212	0.06
213	0.07
214	0.07
215	0.07
216	0.07
217	0.07
218	0.08
219	0.08
220	0.08
221	0.07
222	0.06
223	0.07
224	0.07
225	0.08
226	0.07
227	0.07
228	0.08
229	0.09
230	0.1
231	0.1
232	0.1
233	0.08
234	0.09
235	0.09
236	0.08
237	0.07
238	0.08
239	0.08
240	0.08
241	0.09
242	0.08
243	0.08
244	0.13
245	0.14
246	0.14
247	0.21
248	0.21
249	0.2
250	0.27
251	0.27
252	0.25
253	0.28
254	0.29
255	0.26
256	0.29
257	0.3
258	0.24
259	0.26
260	0.27
261	0.28
262	0.27
263	0.3
264	0.31
265	0.34
266	0.35
267	0.37
268	0.4
269	0.36
270	0.37
271	0.33
272	0.28
273	0.24
274	0.23
275	0.2
276	0.13
277	0.13
278	0.1
279	0.08
280	0.07
281	0.07
282	0.07
283	0.08
284	0.08
285	0.08
286	0.08
287	0.09
288	0.09
289	0.11
290	0.11
291	0.1
292	0.1
293	0.1
294	0.1
295	0.1
296	0.1
297	0.09
298	0.08
299	0.09
300	0.08
301	0.09
302	0.08
303	0.08
304	0.07
305	0.07
306	0.08
307	0.09
308	0.1
309	0.11
310	0.12
311	0.12
312	0.14
313	0.14
314	0.13
315	0.12
316	0.12
317	0.1
318	0.09
319	0.09
320	0.07
321	0.06
322	0.06
323	0.05
324	0.04
325	0.05
326	0.07
327	0.1
328	0.13
329	0.15
330	0.17
331	0.2
332	0.2
333	0.21
334	0.21
335	0.21
336	0.23
337	0.26
338	0.24
339	0.21
340	0.22
341	0.21
342	0.2
343	0.17
344	0.13
345	0.09
346	0.09
347	0.09
348	0.06
349	0.06
350	0.06
351	0.05
352	0.04
353	0.04
354	0.04
355	0.04
356	0.05
357	0.04
358	0.04
359	0.04
360	0.04
361	0.04
362	0.03
363	0.03
364	0.03
365	0.03
366	0.04
367	0.04
368	0.05
369	0.07
370	0.09
371	0.11
372	0.13
373	0.16
374	0.22
375	0.25
376	0.28
377	0.27
378	0.27
379	0.26
380	0.27
381	0.25
382	0.21
383	0.18
384	0.14
385	0.16
386	0.17
387	0.18
388	0.19
389	0.21
390	0.2
391	0.24
392	0.25
393	0.23
394	0.24
395	0.24
396	0.26
397	0.29
398	0.32
399	0.32
400	0.33
401	0.35
402	0.41
403	0.44
404	0.45
405	0.42
406	0.44
407	0.44
408	0.44
409	0.49
410	0.43
411	0.41
412	0.39
413	0.37
414	0.32
415	0.28
416	0.26
417	0.22
418	0.21
419	0.16
420	0.15
421	0.15
422	0.15
423	0.17
424	0.17
425	0.15
426	0.15
427	0.16
428	0.14
429	0.14
430	0.14
431	0.13
432	0.14
433	0.14
434	0.12
435	0.12
436	0.12
437	0.12
438	0.12
439	0.11
440	0.1
441	0.1
442	0.1
443	0.09
444	0.08
445	0.08
446	0.07
447	0.09
448	0.1
449	0.1
450	0.13
451	0.17
452	0.2
453	0.2
454	0.21
455	0.25
456	0.26
457	0.29
458	0.28
459	0.25
460	0.24
461	0.25
462	0.24
463	0.19
464	0.18
465	0.15
466	0.13
467	0.12
468	0.11
469	0.09
470	0.09
471	0.07
472	0.06
473	0.06
474	0.05
475	0.05

G2Q6A5

3D AlphaFold-predicted Structure Viewer