Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QD84

Protein Details
Accession G2QD84    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
2-21AKSARSRVVKENNRRLKQNVHydrophilic
73-104EDAKPASKKLSNKRKVEKRRRKKSSIVFPMRGBasic
NLS Segment(s)
PositionSequence
76-110KPASKKLSNKRKVEKRRRKKSSIVFPMRGPKRNKK
Subcellular Location(s) nucl 18, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG mtm:MYCTH_2315056  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSARSRVVKENNRRLKQNVFGPVEAARAERLSAKLIALATAPKPQKDIEMNEEPANETKEVAAKEDTMDVEDAKPASKKLSNKRKVEKRRRKKSSIVFPMRGPKRNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.75
4 0.71
5 0.68
6 0.65
7 0.63
8 0.56
9 0.5
10 0.47
11 0.43
12 0.37
13 0.3
14 0.23
15 0.15
16 0.11
17 0.11
18 0.11
19 0.12
20 0.12
21 0.13
22 0.12
23 0.12
24 0.12
25 0.12
26 0.1
27 0.11
28 0.09
29 0.15
30 0.16
31 0.15
32 0.16
33 0.16
34 0.2
35 0.22
36 0.24
37 0.24
38 0.28
39 0.3
40 0.29
41 0.29
42 0.26
43 0.23
44 0.22
45 0.15
46 0.1
47 0.08
48 0.11
49 0.11
50 0.12
51 0.11
52 0.1
53 0.11
54 0.12
55 0.11
56 0.09
57 0.1
58 0.09
59 0.08
60 0.09
61 0.09
62 0.09
63 0.1
64 0.09
65 0.13
66 0.18
67 0.25
68 0.35
69 0.46
70 0.54
71 0.63
72 0.73
73 0.8
74 0.87
75 0.9
76 0.91
77 0.91
78 0.93
79 0.94
80 0.91
81 0.9
82 0.89
83 0.89
84 0.89
85 0.87
86 0.8
87 0.76
88 0.79
89 0.77
90 0.74