FuNGI

Q0UNV5

Protein Details

Accession

Q0UNV5

Localization Confidence

High

Confidence Score

16.2

NoLS Segment(s)

Position	Sequence	Protein Nature
96-118	PETPEEKAKRLRKEARRHLRVTF	Basic
439-466	TGNNDRGQGKKHKNRGERPHKVLPCKFF	Basic

NLS Segment(s)

Position	Sequence
101-113	EKAKRLRKEARRH
447-457	GKKHKNRGERP

Subcellular Location(s)

nucl 17.5, cyto_nucl 15, cyto 9.5

Family & Domain DBs

InterPro	View protein in InterPro IPR000571 Znf_CCCH IPR036855 Znf_CCCH_sf
Gene Ontology	GO:0046872 F:metal ion binding
KEGG	pno:SNOG_06559 -
Pfam	View protein in Pfam PF00642 zf-CCCH
PROSITE	View protein in PROSITE PS50103 ZF_C3H1

Amino Acid Sequences

MSTSTLPQKKPTAAPAPVKNREYLPPFNAASKKPATTPAASKPSLQTKPVAAASKDKKPAATTSKPAFSFAQTMASLLKPKEPEAAPVKSEKQLPPETPEEKAKRLRKEARRHLRVTFKPDTALVQIKYFSHDPDEELGHDENFVRHAGDIGGEGAMFKQHKEHDIDDDDDDEPELDNKPWREPSQVDFSAVPTVALDGNYAPYGGGKQMPSCPEKEANLRRENATLMVFYADPNDIPSSPREPLEQDQESAPAVTVTNFGAPPDHVLAKGSQSSQAQVPAPVAIPDLSSLENIFKQFALPAATQPPAMSQPAPVPQTTYAPPMPMASNVDLQSILSALKVPAAPQVQAPPQYPSQAPAAQFPPPSMDFNAIMSAISASAGNGTLPPPPPGFPPFPLPFAMPPQQMDSAAYQLQQQPQYTPQDYNTQTNGGIKRQREETGNNDRGQGKKHKNRGERPHKVLPCKFFQMGKCSKGDNCTYVHDLNM

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.64
2	0.68
3	0.72
4	0.75
5	0.72
6	0.66
7	0.6
8	0.59
9	0.57
10	0.54
11	0.47
12	0.45
13	0.45
14	0.49
15	0.52
16	0.46
17	0.46
18	0.43
19	0.42
20	0.38
21	0.44
22	0.41
23	0.41
24	0.46
25	0.48
26	0.51
27	0.5
28	0.51
29	0.5
30	0.55
31	0.54
32	0.49
33	0.43
34	0.38
35	0.42
36	0.45
37	0.44
38	0.36
39	0.42
40	0.46
41	0.52
42	0.56
43	0.51
44	0.48
45	0.45
46	0.52
47	0.51
48	0.53
49	0.52
50	0.52
51	0.58
52	0.56
53	0.56
54	0.49
55	0.43
56	0.39
57	0.31
58	0.3
59	0.22
60	0.22
61	0.21
62	0.21
63	0.23
64	0.2
65	0.24
66	0.2
67	0.21
68	0.28
69	0.26
70	0.32
71	0.34
72	0.37
73	0.35
74	0.39
75	0.41
76	0.38
77	0.44
78	0.39
79	0.4
80	0.43
81	0.43
82	0.43
83	0.47
84	0.46
85	0.43
86	0.5
87	0.47
88	0.47
89	0.55
90	0.57
91	0.58
92	0.66
93	0.72
94	0.73
95	0.79
96	0.84
97	0.85
98	0.87
99	0.82
100	0.79
101	0.8
102	0.76
103	0.73
104	0.68
105	0.58
106	0.51
107	0.47
108	0.42
109	0.36
110	0.35
111	0.28
112	0.23
113	0.23
114	0.22
115	0.25
116	0.24
117	0.2
118	0.18
119	0.18
120	0.18
121	0.19
122	0.2
123	0.17
124	0.19
125	0.19
126	0.15
127	0.15
128	0.14
129	0.12
130	0.12
131	0.11
132	0.08
133	0.07
134	0.08
135	0.07
136	0.07
137	0.07
138	0.06
139	0.06
140	0.05
141	0.05
142	0.05
143	0.07
144	0.07
145	0.07
146	0.1
147	0.12
148	0.16
149	0.2
150	0.21
151	0.24
152	0.27
153	0.29
154	0.26
155	0.26
156	0.23
157	0.19
158	0.18
159	0.12
160	0.09
161	0.08
162	0.09
163	0.08
164	0.12
165	0.13
166	0.16
167	0.2
168	0.21
169	0.24
170	0.25
171	0.28
172	0.33
173	0.33
174	0.31
175	0.27
176	0.27
177	0.25
178	0.22
179	0.18
180	0.09
181	0.09
182	0.08
183	0.07
184	0.07
185	0.05
186	0.06
187	0.06
188	0.06
189	0.05
190	0.05
191	0.05
192	0.06
193	0.08
194	0.07
195	0.09
196	0.12
197	0.16
198	0.17
199	0.18
200	0.2
201	0.2
202	0.22
203	0.3
204	0.35
205	0.39
206	0.42
207	0.42
208	0.41
209	0.39
210	0.38
211	0.3
212	0.23
213	0.15
214	0.11
215	0.1
216	0.09
217	0.08
218	0.08
219	0.07
220	0.06
221	0.07
222	0.08
223	0.07
224	0.08
225	0.1
226	0.12
227	0.12
228	0.13
229	0.13
230	0.15
231	0.17
232	0.23
233	0.22
234	0.2
235	0.19
236	0.19
237	0.18
238	0.15
239	0.13
240	0.06
241	0.06
242	0.05
243	0.06
244	0.05
245	0.06
246	0.06
247	0.06
248	0.07
249	0.07
250	0.08
251	0.09
252	0.09
253	0.08
254	0.09
255	0.09
256	0.1
257	0.12
258	0.11
259	0.12
260	0.12
261	0.13
262	0.14
263	0.16
264	0.15
265	0.13
266	0.13
267	0.11
268	0.11
269	0.1
270	0.09
271	0.06
272	0.06
273	0.06
274	0.07
275	0.07
276	0.07
277	0.07
278	0.08
279	0.09
280	0.09
281	0.09
282	0.08
283	0.08
284	0.08
285	0.09
286	0.11
287	0.1
288	0.11
289	0.13
290	0.14
291	0.14
292	0.14
293	0.14
294	0.13
295	0.14
296	0.12
297	0.1
298	0.13
299	0.18
300	0.19
301	0.18
302	0.18
303	0.18
304	0.2
305	0.21
306	0.23
307	0.18
308	0.17
309	0.18
310	0.17
311	0.17
312	0.15
313	0.17
314	0.14
315	0.17
316	0.16
317	0.17
318	0.15
319	0.14
320	0.13
321	0.1
322	0.09
323	0.05
324	0.05
325	0.05
326	0.07
327	0.07
328	0.07
329	0.12
330	0.13
331	0.14
332	0.14
333	0.19
334	0.2
335	0.24
336	0.25
337	0.23
338	0.24
339	0.26
340	0.25
341	0.23
342	0.24
343	0.24
344	0.23
345	0.24
346	0.25
347	0.25
348	0.26
349	0.24
350	0.24
351	0.22
352	0.24
353	0.21
354	0.22
355	0.19
356	0.2
357	0.2
358	0.16
359	0.13
360	0.11
361	0.1
362	0.07
363	0.06
364	0.05
365	0.04
366	0.05
367	0.05
368	0.05
369	0.05
370	0.06
371	0.09
372	0.11
373	0.14
374	0.15
375	0.16
376	0.19
377	0.24
378	0.27
379	0.26
380	0.33
381	0.33
382	0.34
383	0.34
384	0.33
385	0.3
386	0.32
387	0.36
388	0.3
389	0.29
390	0.3
391	0.3
392	0.28
393	0.28
394	0.23
395	0.21
396	0.2
397	0.19
398	0.19
399	0.21
400	0.27
401	0.29
402	0.28
403	0.27
404	0.32
405	0.39
406	0.38
407	0.37
408	0.34
409	0.39
410	0.41
411	0.44
412	0.41
413	0.35
414	0.33
415	0.38
416	0.38
417	0.37
418	0.4
419	0.38
420	0.4
421	0.43
422	0.46
423	0.44
424	0.46
425	0.47
426	0.52
427	0.56
428	0.52
429	0.53
430	0.53
431	0.51
432	0.52
433	0.54
434	0.54
435	0.58
436	0.67
437	0.72
438	0.78
439	0.86
440	0.9
441	0.91
442	0.9
443	0.89
444	0.89
445	0.87
446	0.87
447	0.85
448	0.8
449	0.76
450	0.72
451	0.68
452	0.63
453	0.6
454	0.6
455	0.6
456	0.58
457	0.54
458	0.51
459	0.51
460	0.52
461	0.52
462	0.45
463	0.4
464	0.41
465	0.44

Q0UNV5

3D AlphaFold-predicted Structure Viewer