Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QI23

Protein Details
Accession G2QI23    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
105-130GMAALKPRDRTKRKAKAKKRKGMTATBasic
NLS Segment(s)
PositionSequence
110-126KPRDRTKRKAKAKKRKG
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG mtm:MYCTH_2309205  -  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MGHLTHDEFFNRLADIFHARKAKGHGAVYLTQKRLSYSQTSKSPSEQEENPLADLHPAQPLPILIRASNGKGKGDRAAKVKLSTVVQPDELEGFYSRYAEVCKAGMAALKPRDRTKRKAKAKKRKGMTAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.2
3 0.2
4 0.25
5 0.29
6 0.28
7 0.32
8 0.36
9 0.4
10 0.38
11 0.38
12 0.34
13 0.34
14 0.38
15 0.43
16 0.45
17 0.4
18 0.36
19 0.35
20 0.34
21 0.32
22 0.31
23 0.31
24 0.3
25 0.35
26 0.4
27 0.44
28 0.44
29 0.45
30 0.45
31 0.39
32 0.39
33 0.33
34 0.3
35 0.3
36 0.29
37 0.27
38 0.23
39 0.2
40 0.16
41 0.15
42 0.12
43 0.1
44 0.08
45 0.08
46 0.08
47 0.08
48 0.08
49 0.11
50 0.1
51 0.08
52 0.1
53 0.11
54 0.13
55 0.16
56 0.16
57 0.15
58 0.15
59 0.17
60 0.21
61 0.23
62 0.25
63 0.26
64 0.29
65 0.3
66 0.3
67 0.31
68 0.27
69 0.25
70 0.24
71 0.24
72 0.21
73 0.2
74 0.19
75 0.18
76 0.16
77 0.15
78 0.13
79 0.1
80 0.1
81 0.09
82 0.1
83 0.09
84 0.09
85 0.11
86 0.1
87 0.11
88 0.1
89 0.1
90 0.1
91 0.1
92 0.12
93 0.12
94 0.18
95 0.25
96 0.29
97 0.33
98 0.41
99 0.52
100 0.56
101 0.64
102 0.68
103 0.71
104 0.78
105 0.85
106 0.89
107 0.89
108 0.94
109 0.95
110 0.93