Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Q1U1

Protein Details
Accession G2Q1U1   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
129-148VWRNKVKKVFRGKRDKARFEBasic
NLS Segment(s)
PositionSequence
133-147KVKKVFRGKRDKARF
Subcellular Location(s) mito 16, cyto 5.5, cyto_nucl 5.5, nucl 4.5
Family & Domain DBs
KEGG mtm:MYCTH_2313350  -  
Amino Acid Sequences MNARGYGLPTYPGCSTYLPAGSRNYHDQARKLSLCDLSLSDDNHSEHMPCWVKDRKSNLRVSGIHDPANKQRDLKAPPAPQCLGIDAILRNLHHEISSSLKMLQALVQCFEADVEALRPWAEESTLDTVWRNKVKKVFRGKRDKARFEGVAGRISASRAAIKGAVRTVKTVKAAWEDRHTVEGQIRTAKKAIVFCDGIVDLAERAASERAACKQLVTELEETICLLDRRKHPWICKSALLSTCPPNLKASSAGPGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.2
4 0.25
5 0.23
6 0.26
7 0.29
8 0.31
9 0.34
10 0.39
11 0.39
12 0.4
13 0.43
14 0.45
15 0.47
16 0.52
17 0.49
18 0.45
19 0.45
20 0.4
21 0.36
22 0.33
23 0.27
24 0.24
25 0.25
26 0.24
27 0.22
28 0.23
29 0.23
30 0.22
31 0.22
32 0.18
33 0.15
34 0.22
35 0.25
36 0.22
37 0.28
38 0.35
39 0.38
40 0.43
41 0.53
42 0.55
43 0.59
44 0.65
45 0.63
46 0.63
47 0.61
48 0.61
49 0.6
50 0.52
51 0.49
52 0.44
53 0.43
54 0.43
55 0.46
56 0.41
57 0.33
58 0.34
59 0.37
60 0.4
61 0.43
62 0.44
63 0.46
64 0.5
65 0.55
66 0.51
67 0.45
68 0.41
69 0.36
70 0.28
71 0.22
72 0.18
73 0.12
74 0.14
75 0.13
76 0.13
77 0.13
78 0.13
79 0.12
80 0.1
81 0.11
82 0.1
83 0.13
84 0.15
85 0.14
86 0.13
87 0.14
88 0.14
89 0.13
90 0.15
91 0.13
92 0.12
93 0.12
94 0.12
95 0.11
96 0.11
97 0.11
98 0.08
99 0.05
100 0.04
101 0.05
102 0.04
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.04
110 0.06
111 0.1
112 0.11
113 0.11
114 0.11
115 0.13
116 0.17
117 0.22
118 0.21
119 0.2
120 0.28
121 0.33
122 0.41
123 0.51
124 0.55
125 0.6
126 0.7
127 0.74
128 0.78
129 0.82
130 0.79
131 0.71
132 0.68
133 0.58
134 0.5
135 0.49
136 0.39
137 0.32
138 0.27
139 0.24
140 0.18
141 0.18
142 0.16
143 0.1
144 0.1
145 0.08
146 0.08
147 0.1
148 0.1
149 0.11
150 0.14
151 0.17
152 0.16
153 0.19
154 0.2
155 0.21
156 0.23
157 0.23
158 0.22
159 0.26
160 0.29
161 0.3
162 0.33
163 0.33
164 0.32
165 0.34
166 0.32
167 0.26
168 0.26
169 0.25
170 0.22
171 0.27
172 0.27
173 0.26
174 0.26
175 0.26
176 0.25
177 0.26
178 0.26
179 0.24
180 0.24
181 0.21
182 0.23
183 0.22
184 0.19
185 0.16
186 0.14
187 0.08
188 0.08
189 0.08
190 0.05
191 0.06
192 0.07
193 0.07
194 0.07
195 0.11
196 0.14
197 0.17
198 0.17
199 0.16
200 0.17
201 0.2
202 0.22
203 0.23
204 0.21
205 0.19
206 0.19
207 0.19
208 0.18
209 0.15
210 0.15
211 0.12
212 0.13
213 0.2
214 0.25
215 0.32
216 0.41
217 0.48
218 0.53
219 0.62
220 0.67
221 0.65
222 0.66
223 0.63
224 0.62
225 0.58
226 0.55
227 0.5
228 0.48
229 0.5
230 0.46
231 0.43
232 0.39
233 0.37
234 0.34
235 0.33
236 0.3