Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2Q0L6

Protein Details
Accession G2Q0L6    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
24-44QEKKKVPKGRAGKRLKYTRRFBasic
NLS Segment(s)
PositionSequence
12-42GKVKSQTPKVEKQEKKKVPKGRAGKRLKYTR
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mtm:MYCTH_2314011  -  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEKQEKKKVPKGRAGKRLKYTRRFVNITLTGGKRKMNPNPGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.46
4 0.49
5 0.53
6 0.62
7 0.65
8 0.71
9 0.71
10 0.73
11 0.77
12 0.77
13 0.8
14 0.79
15 0.79
16 0.75
17 0.77
18 0.77
19 0.75
20 0.77
21 0.76
22 0.76
23 0.77
24 0.8
25 0.81
26 0.79
27 0.76
28 0.75
29 0.74
30 0.7
31 0.62
32 0.61
33 0.55
34 0.49
35 0.49
36 0.43
37 0.4
38 0.38
39 0.4
40 0.37
41 0.42
42 0.47