Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2Q1T5

Protein Details
Accession G2Q1T5    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-27NGAKAAQKRARNEKHKNVPKAASHydrophilic
NLS Segment(s)
PositionSequence
12-20KRARNEKHK
Subcellular Location(s) nucl 16, cyto_nucl 11.333, mito 6.5, cyto_mito 6.166, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039713  At2g23090-like  
IPR039438  At2g23090-like_Znf  
IPR026939  ZNF706/At2g23090_sf  
KEGG mtm:MYCTH_2294582  -  
Pfam View protein in Pfam  
PF12907  zf-met2  
Amino Acid Sequences MGGGNGAKAAQKRARNEKHKNVPKAASQLKSNAAAMNIICAICKQAFLSTSREPQLTLHAVNKHNATLPQCFPDFKPPASK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.68
3 0.76
4 0.8
5 0.84
6 0.87
7 0.86
8 0.82
9 0.75
10 0.7
11 0.68
12 0.64
13 0.56
14 0.48
15 0.44
16 0.4
17 0.37
18 0.33
19 0.24
20 0.18
21 0.16
22 0.13
23 0.11
24 0.09
25 0.07
26 0.06
27 0.06
28 0.07
29 0.06
30 0.06
31 0.06
32 0.06
33 0.08
34 0.1
35 0.16
36 0.18
37 0.22
38 0.24
39 0.23
40 0.23
41 0.22
42 0.25
43 0.22
44 0.21
45 0.23
46 0.27
47 0.29
48 0.31
49 0.32
50 0.28
51 0.28
52 0.29
53 0.28
54 0.27
55 0.28
56 0.3
57 0.3
58 0.31
59 0.31
60 0.38
61 0.39