Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H6C9S4

Protein Details
Accession H6C9S4    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
159-181LCDNRKMVCKKLKNKYNALESFRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, extr 11, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MKISAGILVSVLTLTSAAPFNPGHSGADDGAPFNGIINPRNRPLQRVGAEIPAGHDVPQARFHGHAKAMKRDPLAEAEAEADPFYPLKPGAPSAGKPPHGDLMSKFAHGYGFGHGPVVNPNPRPKVKVGRRNAAGPANWYGSHNSVGPKKGKLPSAEDLCDNRKMVCKKLKNKYNALESFRNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.06
3 0.06
4 0.06
5 0.09
6 0.1
7 0.11
8 0.14
9 0.15
10 0.15
11 0.15
12 0.18
13 0.16
14 0.18
15 0.17
16 0.14
17 0.13
18 0.13
19 0.11
20 0.09
21 0.11
22 0.1
23 0.14
24 0.18
25 0.22
26 0.24
27 0.33
28 0.33
29 0.35
30 0.38
31 0.43
32 0.41
33 0.42
34 0.41
35 0.36
36 0.36
37 0.31
38 0.28
39 0.21
40 0.19
41 0.14
42 0.14
43 0.12
44 0.13
45 0.17
46 0.17
47 0.15
48 0.17
49 0.19
50 0.21
51 0.24
52 0.26
53 0.26
54 0.34
55 0.36
56 0.38
57 0.37
58 0.34
59 0.31
60 0.3
61 0.27
62 0.19
63 0.16
64 0.13
65 0.13
66 0.12
67 0.1
68 0.07
69 0.06
70 0.06
71 0.06
72 0.05
73 0.05
74 0.05
75 0.06
76 0.07
77 0.09
78 0.11
79 0.11
80 0.18
81 0.23
82 0.24
83 0.24
84 0.24
85 0.26
86 0.25
87 0.25
88 0.19
89 0.19
90 0.18
91 0.18
92 0.17
93 0.13
94 0.12
95 0.12
96 0.12
97 0.08
98 0.08
99 0.08
100 0.09
101 0.09
102 0.09
103 0.12
104 0.15
105 0.17
106 0.19
107 0.24
108 0.31
109 0.32
110 0.35
111 0.37
112 0.44
113 0.51
114 0.58
115 0.6
116 0.63
117 0.64
118 0.64
119 0.64
120 0.58
121 0.48
122 0.41
123 0.37
124 0.3
125 0.28
126 0.26
127 0.24
128 0.21
129 0.21
130 0.2
131 0.21
132 0.23
133 0.28
134 0.3
135 0.31
136 0.36
137 0.39
138 0.43
139 0.41
140 0.44
141 0.47
142 0.5
143 0.49
144 0.46
145 0.47
146 0.45
147 0.46
148 0.4
149 0.34
150 0.36
151 0.37
152 0.42
153 0.48
154 0.54
155 0.6
156 0.7
157 0.78
158 0.78
159 0.84
160 0.83
161 0.83
162 0.81
163 0.78