Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H6BNC5

Protein Details
Accession H6BNC5    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
198-231RGEGRRERLERMKRQERRQRNNERRGRKGGSKVGBasic
NLS Segment(s)
PositionSequence
107-139RWKPLPKPKAPTKWELFARKKGIGKYGGSLKGG
197-231VRGEGRRERLERMKRQERRQRNNERRGRKGGSKVG
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MVDTTMAEGGSSTSKTNTEKERPSTTVSKPTPYTFDLGYLTATDPNPLPPTSTLLSQTYSERNETLKTIARDGAQVLLNTLLTTCTITSTPDGLVMSLPAPTNPLPRWKPLPKPKAPTKWELFARKKGIGKYGGSLKGGAALEERKKNLVYDEEKGEWVKKWGFKGKNKQGENDWLVELDDDKLNKEKDNEGSGRTVRGEGRRERLERMKRQERRQRNNERRGRKGGSKVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.25
4 0.32
5 0.39
6 0.45
7 0.51
8 0.56
9 0.56
10 0.59
11 0.6
12 0.57
13 0.59
14 0.54
15 0.54
16 0.5
17 0.49
18 0.48
19 0.42
20 0.4
21 0.3
22 0.29
23 0.24
24 0.21
25 0.19
26 0.16
27 0.15
28 0.16
29 0.15
30 0.14
31 0.13
32 0.15
33 0.18
34 0.17
35 0.18
36 0.15
37 0.2
38 0.2
39 0.21
40 0.21
41 0.2
42 0.22
43 0.21
44 0.22
45 0.23
46 0.23
47 0.23
48 0.21
49 0.21
50 0.21
51 0.21
52 0.21
53 0.23
54 0.22
55 0.23
56 0.24
57 0.23
58 0.22
59 0.21
60 0.21
61 0.16
62 0.15
63 0.13
64 0.12
65 0.11
66 0.1
67 0.09
68 0.06
69 0.05
70 0.06
71 0.05
72 0.06
73 0.06
74 0.07
75 0.08
76 0.09
77 0.08
78 0.09
79 0.09
80 0.08
81 0.08
82 0.07
83 0.06
84 0.07
85 0.06
86 0.05
87 0.07
88 0.08
89 0.12
90 0.12
91 0.2
92 0.21
93 0.24
94 0.32
95 0.36
96 0.45
97 0.52
98 0.6
99 0.59
100 0.66
101 0.71
102 0.74
103 0.72
104 0.69
105 0.62
106 0.59
107 0.58
108 0.6
109 0.56
110 0.52
111 0.53
112 0.5
113 0.51
114 0.45
115 0.44
116 0.38
117 0.34
118 0.3
119 0.32
120 0.3
121 0.27
122 0.26
123 0.21
124 0.21
125 0.2
126 0.17
127 0.12
128 0.14
129 0.19
130 0.22
131 0.23
132 0.2
133 0.2
134 0.21
135 0.21
136 0.25
137 0.24
138 0.24
139 0.28
140 0.27
141 0.28
142 0.29
143 0.28
144 0.22
145 0.22
146 0.23
147 0.22
148 0.27
149 0.35
150 0.42
151 0.5
152 0.61
153 0.67
154 0.72
155 0.71
156 0.69
157 0.64
158 0.65
159 0.58
160 0.49
161 0.39
162 0.3
163 0.28
164 0.24
165 0.2
166 0.13
167 0.13
168 0.1
169 0.12
170 0.17
171 0.18
172 0.2
173 0.22
174 0.25
175 0.27
176 0.34
177 0.35
178 0.32
179 0.36
180 0.35
181 0.35
182 0.31
183 0.3
184 0.27
185 0.32
186 0.37
187 0.38
188 0.45
189 0.51
190 0.53
191 0.58
192 0.63
193 0.67
194 0.69
195 0.73
196 0.76
197 0.77
198 0.85
199 0.89
200 0.9
201 0.9
202 0.91
203 0.92
204 0.92
205 0.94
206 0.93
207 0.92
208 0.9
209 0.88
210 0.85
211 0.83