Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H6BNS1

Protein Details
Accession H6BNS1    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
42-67SQICRTVRPLRTPGRRARHREPSASAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 9, cyto_nucl 8.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MASVLPRRRGGIRAACDRCYELKERCERASTTSACVRCNRLSQICRTVRPLRTPGRRARHREPSASASQTISSRSSTEASSQSQDENGAWLQDVPDLVLEERELMMFLLYRRQTLQFNVVSPSFEDAARRSFEAPLLAALPVLKDAYLAYAGGLKASFHADNDTPTVADEDANLSLHHASSALETLRTLPVGSSEDAALCLTLGMVLALYIYSAVGVGAPDICHYCLGVASPYIEDSTISFETEPQLIFMVLLETMDCAVHRHKPTLRLRVQSPAASERVGVDRHLGLCVPLLPYYYDLCVISHFLIDGKNASLVAILHRHLRRIQAAVNTWQPCPPEGFVHEFSSVEVVHLLAQARVYRLAALLMAHRLQHHFGHENADAQADIWSREIMMELEMARRVTQQPIRFVTLPFIVAAIEIRDPVARIKADENVDEYVDRFMPVVQEATRTFLSRIWRERDVGAISSWFDSVHKPCVTLDALGDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.57
3 0.56
4 0.57
5 0.52
6 0.48
7 0.46
8 0.43
9 0.47
10 0.54
11 0.58
12 0.57
13 0.59
14 0.55
15 0.55
16 0.57
17 0.5
18 0.46
19 0.48
20 0.47
21 0.45
22 0.48
23 0.48
24 0.43
25 0.47
26 0.49
27 0.51
28 0.54
29 0.58
30 0.64
31 0.65
32 0.64
33 0.65
34 0.66
35 0.63
36 0.66
37 0.67
38 0.67
39 0.7
40 0.76
41 0.78
42 0.8
43 0.83
44 0.84
45 0.85
46 0.86
47 0.83
48 0.8
49 0.76
50 0.72
51 0.7
52 0.64
53 0.55
54 0.46
55 0.41
56 0.35
57 0.32
58 0.27
59 0.2
60 0.18
61 0.19
62 0.19
63 0.18
64 0.21
65 0.22
66 0.23
67 0.25
68 0.26
69 0.24
70 0.23
71 0.23
72 0.19
73 0.18
74 0.15
75 0.12
76 0.11
77 0.11
78 0.1
79 0.1
80 0.1
81 0.07
82 0.08
83 0.08
84 0.08
85 0.08
86 0.08
87 0.07
88 0.08
89 0.07
90 0.07
91 0.06
92 0.06
93 0.07
94 0.07
95 0.14
96 0.14
97 0.16
98 0.17
99 0.2
100 0.22
101 0.23
102 0.3
103 0.25
104 0.26
105 0.28
106 0.27
107 0.25
108 0.23
109 0.23
110 0.17
111 0.15
112 0.15
113 0.14
114 0.17
115 0.18
116 0.18
117 0.17
118 0.17
119 0.17
120 0.17
121 0.15
122 0.13
123 0.12
124 0.11
125 0.09
126 0.08
127 0.07
128 0.07
129 0.06
130 0.05
131 0.05
132 0.05
133 0.06
134 0.06
135 0.06
136 0.05
137 0.08
138 0.08
139 0.08
140 0.08
141 0.07
142 0.07
143 0.1
144 0.1
145 0.08
146 0.11
147 0.11
148 0.13
149 0.15
150 0.14
151 0.11
152 0.11
153 0.12
154 0.09
155 0.09
156 0.08
157 0.08
158 0.08
159 0.08
160 0.08
161 0.08
162 0.08
163 0.07
164 0.07
165 0.06
166 0.05
167 0.06
168 0.08
169 0.07
170 0.07
171 0.07
172 0.09
173 0.09
174 0.09
175 0.08
176 0.06
177 0.08
178 0.1
179 0.1
180 0.09
181 0.09
182 0.09
183 0.09
184 0.09
185 0.07
186 0.05
187 0.04
188 0.03
189 0.03
190 0.03
191 0.02
192 0.02
193 0.02
194 0.02
195 0.02
196 0.02
197 0.02
198 0.02
199 0.02
200 0.02
201 0.02
202 0.02
203 0.02
204 0.03
205 0.03
206 0.03
207 0.04
208 0.05
209 0.05
210 0.05
211 0.05
212 0.05
213 0.05
214 0.05
215 0.05
216 0.05
217 0.05
218 0.05
219 0.05
220 0.06
221 0.05
222 0.05
223 0.05
224 0.09
225 0.08
226 0.09
227 0.08
228 0.09
229 0.1
230 0.11
231 0.1
232 0.06
233 0.06
234 0.06
235 0.06
236 0.05
237 0.05
238 0.04
239 0.04
240 0.03
241 0.03
242 0.03
243 0.03
244 0.03
245 0.04
246 0.06
247 0.13
248 0.14
249 0.19
250 0.21
251 0.31
252 0.38
253 0.47
254 0.51
255 0.49
256 0.5
257 0.52
258 0.52
259 0.44
260 0.39
261 0.32
262 0.27
263 0.23
264 0.21
265 0.16
266 0.16
267 0.15
268 0.13
269 0.11
270 0.11
271 0.12
272 0.12
273 0.1
274 0.08
275 0.08
276 0.09
277 0.08
278 0.07
279 0.07
280 0.07
281 0.09
282 0.1
283 0.1
284 0.1
285 0.09
286 0.09
287 0.09
288 0.1
289 0.09
290 0.08
291 0.07
292 0.07
293 0.07
294 0.08
295 0.08
296 0.07
297 0.07
298 0.07
299 0.07
300 0.07
301 0.06
302 0.08
303 0.09
304 0.1
305 0.17
306 0.18
307 0.2
308 0.21
309 0.25
310 0.25
311 0.26
312 0.29
313 0.27
314 0.3
315 0.32
316 0.37
317 0.35
318 0.33
319 0.33
320 0.3
321 0.25
322 0.25
323 0.22
324 0.17
325 0.18
326 0.24
327 0.25
328 0.27
329 0.26
330 0.24
331 0.22
332 0.21
333 0.18
334 0.12
335 0.1
336 0.07
337 0.07
338 0.08
339 0.09
340 0.07
341 0.09
342 0.1
343 0.11
344 0.11
345 0.11
346 0.1
347 0.1
348 0.09
349 0.09
350 0.08
351 0.09
352 0.11
353 0.11
354 0.12
355 0.13
356 0.15
357 0.17
358 0.18
359 0.21
360 0.21
361 0.21
362 0.26
363 0.25
364 0.26
365 0.24
366 0.22
367 0.17
368 0.15
369 0.17
370 0.12
371 0.12
372 0.1
373 0.1
374 0.09
375 0.1
376 0.1
377 0.08
378 0.07
379 0.08
380 0.08
381 0.1
382 0.12
383 0.13
384 0.12
385 0.14
386 0.16
387 0.22
388 0.28
389 0.31
390 0.37
391 0.41
392 0.46
393 0.45
394 0.44
395 0.4
396 0.35
397 0.31
398 0.23
399 0.19
400 0.13
401 0.12
402 0.12
403 0.09
404 0.08
405 0.07
406 0.08
407 0.08
408 0.09
409 0.11
410 0.16
411 0.15
412 0.17
413 0.19
414 0.25
415 0.27
416 0.28
417 0.29
418 0.26
419 0.26
420 0.24
421 0.22
422 0.19
423 0.16
424 0.15
425 0.12
426 0.11
427 0.12
428 0.13
429 0.15
430 0.13
431 0.17
432 0.17
433 0.22
434 0.23
435 0.23
436 0.23
437 0.23
438 0.31
439 0.35
440 0.42
441 0.44
442 0.47
443 0.48
444 0.48
445 0.5
446 0.45
447 0.38
448 0.32
449 0.27
450 0.24
451 0.23
452 0.22
453 0.17
454 0.14
455 0.18
456 0.2
457 0.27
458 0.26
459 0.26
460 0.26
461 0.31
462 0.32
463 0.27