Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6BVP9

Protein Details
Accession H6BVP9   
Localization Confidence Low
Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
185-208PSTTCYFCFKKRRKADMRFIRDMTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_nucl 9, mito 6, nucl 2.5, plas 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR033684  EFM6  
IPR019410  Methyltransf_16  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0016279  F:protein-lysine N-methyltransferase activity  
GO:0018022  P:peptidyl-lysine methylation  
Pfam View protein in Pfam  
PF10294  Methyltransf_16  
Amino Acid Sequences MSASRSPSPENDVFAMATNLVPERENKTAATTSLTFDGLLPDSAPLLLHEDLQEGCGGQLWPAGMVLAKYMLTYHKTQSLLGKSIVEIGAGGGLVGLAVALGCEVDTKIWVTDQLPMLALMQKNVELNKLEAKVGAAIYDWGSPPPADILRNGTEQPDIVLAADCVYFEPAFPLLLQTLTDLIGPSTTCYFCFKKRRKADMRFIRDMTKKFAVEQISYAGRDSDQREGIFLYQVRKKEKTNSVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.17
4 0.15
5 0.12
6 0.11
7 0.11
8 0.11
9 0.13
10 0.18
11 0.2
12 0.22
13 0.21
14 0.25
15 0.26
16 0.26
17 0.28
18 0.24
19 0.22
20 0.22
21 0.22
22 0.18
23 0.16
24 0.17
25 0.13
26 0.13
27 0.11
28 0.09
29 0.09
30 0.09
31 0.09
32 0.07
33 0.1
34 0.1
35 0.1
36 0.1
37 0.12
38 0.12
39 0.12
40 0.12
41 0.07
42 0.07
43 0.08
44 0.08
45 0.06
46 0.08
47 0.07
48 0.07
49 0.07
50 0.07
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.08
59 0.11
60 0.13
61 0.14
62 0.19
63 0.2
64 0.21
65 0.26
66 0.28
67 0.28
68 0.27
69 0.25
70 0.2
71 0.21
72 0.2
73 0.13
74 0.09
75 0.07
76 0.06
77 0.05
78 0.05
79 0.02
80 0.02
81 0.02
82 0.02
83 0.02
84 0.01
85 0.01
86 0.01
87 0.01
88 0.01
89 0.01
90 0.02
91 0.02
92 0.02
93 0.03
94 0.04
95 0.04
96 0.04
97 0.05
98 0.06
99 0.1
100 0.1
101 0.1
102 0.1
103 0.1
104 0.1
105 0.12
106 0.12
107 0.09
108 0.08
109 0.08
110 0.09
111 0.09
112 0.1
113 0.08
114 0.09
115 0.12
116 0.13
117 0.12
118 0.11
119 0.11
120 0.11
121 0.1
122 0.09
123 0.06
124 0.05
125 0.06
126 0.07
127 0.07
128 0.06
129 0.07
130 0.06
131 0.06
132 0.08
133 0.08
134 0.08
135 0.09
136 0.13
137 0.15
138 0.17
139 0.17
140 0.16
141 0.15
142 0.14
143 0.14
144 0.1
145 0.08
146 0.07
147 0.06
148 0.05
149 0.06
150 0.06
151 0.05
152 0.05
153 0.06
154 0.06
155 0.05
156 0.07
157 0.07
158 0.07
159 0.07
160 0.08
161 0.07
162 0.07
163 0.08
164 0.07
165 0.07
166 0.07
167 0.07
168 0.06
169 0.06
170 0.07
171 0.06
172 0.07
173 0.1
174 0.1
175 0.1
176 0.16
177 0.19
178 0.27
179 0.38
180 0.46
181 0.54
182 0.64
183 0.74
184 0.79
185 0.86
186 0.88
187 0.89
188 0.89
189 0.85
190 0.77
191 0.75
192 0.71
193 0.64
194 0.6
195 0.55
196 0.46
197 0.4
198 0.43
199 0.39
200 0.33
201 0.32
202 0.3
203 0.27
204 0.27
205 0.26
206 0.21
207 0.18
208 0.21
209 0.23
210 0.24
211 0.26
212 0.25
213 0.26
214 0.27
215 0.27
216 0.28
217 0.28
218 0.28
219 0.29
220 0.36
221 0.42
222 0.44
223 0.48
224 0.53