Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6BRI0

Protein Details
Accession H6BRI0    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
88-107SLFPRKRPPCTRPEMQRQSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 6, cyto 4, plas 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MTHAILSLPATVDLPWRWPMVDWQVGVPWAWVSAAASSSTPSTARIAVAPSCISAVRNVLQPCECLTASASDSDSSGKVGMQSPPWLSLFPRKRPPCTRPEMQRQSSQLHRFAAIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.16
4 0.16
5 0.17
6 0.21
7 0.24
8 0.28
9 0.25
10 0.23
11 0.24
12 0.24
13 0.23
14 0.19
15 0.12
16 0.08
17 0.07
18 0.06
19 0.05
20 0.05
21 0.06
22 0.06
23 0.06
24 0.07
25 0.07
26 0.08
27 0.08
28 0.09
29 0.09
30 0.09
31 0.09
32 0.09
33 0.11
34 0.1
35 0.11
36 0.1
37 0.09
38 0.09
39 0.09
40 0.08
41 0.07
42 0.09
43 0.08
44 0.13
45 0.13
46 0.14
47 0.14
48 0.14
49 0.15
50 0.17
51 0.15
52 0.11
53 0.12
54 0.12
55 0.12
56 0.12
57 0.12
58 0.08
59 0.09
60 0.09
61 0.09
62 0.08
63 0.07
64 0.07
65 0.07
66 0.1
67 0.11
68 0.12
69 0.15
70 0.15
71 0.17
72 0.18
73 0.17
74 0.17
75 0.26
76 0.32
77 0.38
78 0.48
79 0.51
80 0.6
81 0.69
82 0.73
83 0.73
84 0.73
85 0.74
86 0.73
87 0.79
88 0.8
89 0.76
90 0.77
91 0.71
92 0.7
93 0.7
94 0.66
95 0.6
96 0.52